KEGG   Oryza brachyantha (malo sina): 102713292Help
Entry
102713292         CDS       T02995                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00010  Glycolysis / Gluconeogenesis
obr00020  Citrate cycle (TCA cycle)
obr00620  Pyruvate metabolism
obr01100  Metabolic pathways
obr01110  Biosynthesis of secondary metabolites
obr01200  Carbon metabolism
Module
obr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:obr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102713292
   00020 Citrate cycle (TCA cycle)
    102713292
   00620 Pyruvate metabolism
    102713292
Enzymes [BR:obr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     102713292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118
Motif
Other DBs
NCBI-GeneID: 102713292
NCBI-ProteinID: XP_006659425
UniProt: J3MT78
LinkDB All DBs
Position
8
AA seq 455 aa AA seqDB search
MATAPATLSLSSAALPARLRVGRAGPAKIREIFMPALSSTMTEGKIVSWTAAEGDRVSKG
DAVVVVESDKADMDVETFHDGIVAAVLVPAGESAPVGAPIALLAESEEEVQAALAKAQEL
SKGQPQQAPPPSDSAEPPPPPPPAAAPAAAPAPVAAGTKGIATPQAKKLAKQHRVDLAKV
TGTGPFGRITPGDVEAAAGIQPKPKVAPAATAALSAPVIGAVPQAAVLPPVPGATVVPFT
GMQAAVSKNMVESLSVPAFRVGYPIVTDKLDALYEKVKSKGVTMTVLLAKAAAMALAQHP
VVNASCRDGKSFTYNSNINIAVAVAIDGGLITPVLEDADKLDIYLLSQKWKELVKKARAK
QLQPNEYSSGTFTLSNLGMFGVDRFDAILPPGQGGIMAVGASKPTVVADKDGFFSVKSKM
LVNVTADHRIVYGADLAAFLQTFAKIIEDPESLTL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggcgccggcgaccctctcgctctcctccgccgcgttgccggcgcgcctacgc
gtcgggcgggcggggccggccaagatccgggagatcttcatgccggcgctcagctccacc
atgacggaggggaagatagtctcctggacggccgccgagggggaccgcgtcagcaagggg
gacgccgtggtggtcgtcgagtccgacaaggccgacatggacgtcgagacgttccacgac
ggcatcgtcgcggccgtgctcgtccccgccggggagtccgcccccgtcggggcccccatc
gcgctgctcgcggagtccgaggaggaggtccaggccgccctcgccaaggcccaagagctc
tccaagggccagccgcagcaggcccctccaccgtccgattccgctgagccgccgccgcct
cctccgcccgcggctgctccagccgctgctcccgcaccggtggcagctggcacgaagggc
attgccaccccgcaagctaagaagcttgccaagcagcacagggtggacctcgctaaggtg
actggcactgggccgttcggacgaattacgccgggcgacgttgaggctgccgctggcatc
caaccgaaacctaaggttgctcctgctgccactgcggctctttctgctccggtgattggg
gccgttccacaggcggcggtgcttcctccagtgcccggtgcaacggtggttccattcacc
ggtatgcaggctgcagtgagcaagaacatggtggagagcctctcggtgccagcattccgt
gtgggatacccaatcgtgaccgataagctcgatgcgctatatgagaaggtcaagtcaaag
ggggtgaccatgacggttctgctggcaaaggctgcagctatggcgcttgcgcagcatcct
gtggtgaacgctagctgcagggatgggaagagcttcacttacaacagcaacatcaacatt
gcggtggccgtcgcaattgatggtggactcattacacctgttctggaggatgctgataag
ctggatatatatttgctctcacaaaaatggaaggaactagtcaagaaggctcgtgcaaaa
cagctccaaccaaatgaatacagctctgggacatttacactatcaaacttgggtatgttt
ggtgtagataggtttgatgcaattcttccacctggccagggaggcataatggctgttgga
gcctcaaaacctacagtggtagctgataaagatggtttctttagtgtcaagagcaaaatg
ctggtcaatgtcactgcggatcacagaattgtatatggtgctgatctggcagcattcctg
caaacttttgcaaagattattgaggatcctgagagcttaactttgtaa

DBGET integrated database retrieval system