KEGG   Oryza brachyantha (malo sina): 102713819Help
Entry
102713819         CDS       T02995                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00564  Glycerophospholipid metabolism
obr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:obr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102713819
Enzymes [BR:obr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     102713819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C
Motif
Other DBs
NCBI-GeneID: 102713819
NCBI-ProteinID: XP_006653210
LinkDB All DBs
Position
4
AA seq 549 aa AA seqDB search
ATGCGVALDAATRGLRVGLVEREDFSSGASSRSTKLIHGGVRYLEKAVFNLDYGQLKLVF
HALKERKQVIENAPHLCHALPCMTPCFNWFEVVYYWFGLKFYDIVAGRRLLHLSRYYSVD
ESVELFPTLAKNSHDRSLRGTVVYYDGQMNDSRLNVGLACTAGVLGAAILNYAEVVSLIK
DESGERVIGARIRDTLSGKEFDAFAKVVVNAAGPFCDSVRKMANNDVVPMICPSSGVHIV
LPDYYSPDGMGLIVPKTKDGRVVFMLPWLGRTVAGTTDSSTAITMLPEPHEDEIQFILDA
ICDYLNVQVRRSDVLSAWSGIRPLAVDPSAKSTESISRDHVVFEDYPGLITITGGKWTTY
RSMAEDAVNAAIRSGNLKPANGCVTDHLHILGGYGWDPASFTVLAQNYKRMKRTYGGKII
PGAMDSAVSKHLSHAYGTLATQVAAIAQDEGLGKRLAHGYPFLEAEVAYCARHEYCESAV
DFIARRCRLAFLDTDAAGRALPRIIEILAMEYKWDKARQKLELQKGKEFLETFKSSKNAQ
FRDGKHNGQ
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
gccaccgggtgcggcgtcgcgctcgacgccgccactcgggggctccgggtcggcctcgtg
gagcgcgaggacttctcctctggggcatcgtcccgatccaccaaactcatccatggcggt
gtgcgttacttggagaaggcagtattcaatctcgattatgggcagctgaaacttgttttt
catgctttgaaggaacgcaagcaggttattgagaatgcaccccacttatgccatgctttg
ccatgcatgactccttgctttaactggtttgaggttgtatactattggtttggcctgaaa
ttctatgatatcgttgctggaagaaggttgctacatttgtcacgatattattctgtagat
gaatcagttgaacttttcccaacccttgcaaaaaacagccatgaccgtagcctaagaggg
acagtggtatactatgatggtcaaatgaatgacagtcgtctgaatgtgggtttggcatgc
accgcgggagttcttggtgcagccattcttaattatgctgaagtggtatccctaattaag
gatgaatctggagaaagggtcattggtgcacggattcgtgatacgctatcaggtaaagaa
ttcgacgcatttgcaaaggtggttgttaacgcagcaggaccgttttgtgactctgtgagg
aagatggctaacaatgatgtagtgcccatgatctgtccaagcagtggagtacacattgta
cttcctgattattattcccctgatgggatgggactaattgtccctaaaaccaaggatggt
agagttgtatttatgcttccgtggttaggaaggacggtagctggtacaactgattctagt
acagcaataacaatgcttcctgaaccacatgaggatgaaatacagttcatattagatgct
atctgtgactatcttaatgttcaggtaaggcgttcagatgttctttctgcctggagtgga
atacgtccactggctgtggatccatcagcaaaaagtactgagagcatttccagagatcat
gttgtgtttgaagactatccaggactaataactatcactggtggaaaatggacaacttat
cgaagcatggctgaagatgctgttaatgcagccataaggtcagggaatttgaagcctgcc
aatggctgtgtaactgatcatctgcatattctgggtggatatggatgggatcctgcttct
tttactgtccttgcgcagaattataaacggatgaaaaggacatatggtgggaaaatcatt
ccaggtgcaatggacagtgctgtatcgaaacatctgtcacacgcatatggaactttggct
acacaagtggctgcaatcgcccaggatgaaggcttggggaagcgacttgctcatggatac
ccatttttggaggctgaagtagcttactgtgctcgccacgagtactgtgaatctgctgtg
gacttcattgcgaggagatgccgacttgcatttcttgacacagatgctgctggaagagca
ttgcctcggatcatcgagattttagctatggaatacaagtgggacaaggcaaggcagaag
cttgaattgcaaaagggtaaagaattcttggaaacattcaaatcatccaagaatgcacaa
ttcagggatggaaaacataatggtcaatga

DBGET integrated database retrieval system