KEGG   Oryza brachyantha (malo sina): 102715629Help
Entry
102715629         CDS       T02995                                 

Definition
(RefSeq) serine/threonine-protein kinase ATM
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:obr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    102715629
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:obr01001]
    102715629
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:obr03032]
    102715629
   03400 DNA repair and recombination proteins [BR:obr03400]
    102715629
Enzymes [BR:obr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102715629
Protein kinases [BR:obr01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   102715629
DNA replication proteins [BR:obr03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     102715629
DNA repair and recombination proteins [BR:obr03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    102715629
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FATC
Motif
Other DBs
NCBI-GeneID: 102715629
NCBI-ProteinID: XP_015699193
LinkDB All DBs
Position
1
AA seq 2761 aa AA seqDB search
MECVNTFLLKDGPNLGCKSVDIHNAIQDFMFHSWPMTHDRALKSLFITYAKVQLKLARAI
PEILEKLLDVIIKELDHHFNTGSSLVWCEAPRDEKAGSLRCFQEELMDLSATVLYQACKC
TPRTSNNEKKLKTEHVMTIIMDSLLKGSLVWSGSIYYLIHKYGYRVDKSLLISWFEATCK
GLKSVLSNTNALRFQDSLLWLIRVLKEFSALLVLDARNETPFLLTKGEMSNFEGYWQDTW
NCLIHALPLFSTTALVADSVLRLLSEMIMRDQVHASFVSEDTWDLQIFKQLPSSSALYFV
ACYFSKIGIQGDLSNSIFIRKNLLRSTLELVHSKGFSLLNEQNVLMIPETIFALCAGFSS
PMINLADTSQLFGECKDISKLYRKDESWSHEEELGYSVEALSEINLESPTKVMSDKCTQA
HLPRHIQQPLFLELLEFTKGFMSNEQFEQVDLPNLVYACALVCNLIHCSLLSRVIDEKSS
FLQAMLDYVTNIIKHTVSVVMKEHAELSNGLTNLGSAFDTTGSVLSSFKSFMCSPIFSLW
RVNNKVSSVHDATEFLDELLVAISQLFSQLSSLMNNFDGDNPSKILPVSVVSLSEDINPD
GRSSLVDMDLDMTGTGEVDPVTAGGSGSMGISPRPLEYKLQLVYIISTFFSVVPLHTWEV
LYDLAEKEVDVKAGQAILLELCTNISASSRSLSSVLNLVVDMWDRSAFSLLSSADCLTHV
HALIRNLTANCDVGHNTDGKSQGFEVAPNENQDILLNLVNRATEISSTDWFFRTRLINCI
SQFIYLFPDVAQDMIGHLLSMLHDTDYRVRLYLARKIVVLFQVWEGHSELFHDVCSNIGV
KMVQFSNENPVKAREVLAIGPQPVPIIETALITLAHLSLQSEDVEVECIFMISAVAAIEP
SQRELAYALFDSVSKRLSYASRSKYLDQLIGPILFRWVACEVSLVSLVEVEEMFGFKSAE
PKNFIEHCCPWLLSFLILRGDTADLNWLSKILSQPLSAVIKRYFVPIFGLCIAARCGSGP
EKDISETVLCESLLQLGEISEPERDDLIKKHMVSIVGFLLSVSSSSRQPEIPHFSKEAVV
HSVKTVVDGFMEAMDGNLAETVVIDKINIFRSDRVFKFLLSIHQQIADANHPRHMRHRLC
AIEVLIDVLGHRVALYSTWFYIICIVGSYIWRQPLQGQCCNILSKLLVAFNSNSSTETVP
ALGKQLQLLVPKLVTCCLRNEKEGKCAIADSSRVLSLLRQLTVDADPLLYDYIRDLEPLP
SLDCLKDIQVFHASLSSSYDSRDQFLKFVSRAPHLPPDLFLLSLRMHHKNLLSGEIICRG
DASVDNADTVSCWHSDPDVVSAVWTLVDFCSSSFVANEASSVLADFISRAGISDVHQVIF
HVPNLSEKYPIQLDISKDKLYSGYGISDDILVGLLKLLKTCLSDDSVEIIDVTSRTLRGI
LSTASGLNALQSLDSLDRSLLMVHSRGINSQLVEQTLLGMENVSGVSLEDRDLWRTDGRS
YKQWLCTLVGSLICHCDDIILRLCRSLAFLKVEAAEILLASALVNIAGNLDSNAGICRLI
STMVEEIIFCDSNHLMKSVHLFLDALNVVRSYCVAEKARGCPSNALKDGRSVRSKSRSPT
TTPSSSWKKVYWLSVDYLVAARAANRCSCDFATIMYVELWCEEKFNMLLLGPPDFSHEEL
LPPHIGLLLDAFTRINELDSIYGITLANEISSQIIRYEHEGDWSSALEYHDILVRSTRKE
NLSSLPGTSLTGPSDAPSKAEKKMLNWQMHKGLMRSLQKTGCSHVLDVYCQGLSSQKSCL
QDSEFIDIQYETAWRAGNWDFSFLAPYSSQPSTLSQSYCLFNQSLHSCLRALQSGDSEEF
HVKLSNSKMNLVLALSNASKESTKCIHSTVLKLQMLDHLTMVWDLRWKFCPNHTSKSYVG
TKDFSPVPTVPTRMQLELLNKEWTSILCQTERNFDLLEPFLAFRSAVLKILGCEEHLREH
LFQSASALRKGARFSLAAAALYELKELCYQMEHQAMPKSYFLFKLEEAKLLRAQGQHDMA
ISLGKYILKNHPDKKDISDVYRLVGKWLAETRSSNSRTIIDDYLRHSVDLTESHKSSDKK
YKSRQCRTYFHLAHYTDGLFKSYEERLSSNEWQAALRLRKYKTRELETLIKRLKSSSKSE
KTDYSVKIQELQRQLALDREEAEKIQDDRDKFLSLALQGYQRSLAVGGKYDLQVVFRLVS
LWFSLFSREQVVKAMIKTTKEVQTYKFIPLVYQIASRLGSSKDVHGSSNFQNALSSLLKK
MAIDHPYHTIFQLLALANGDRVKDRQRSRSSFIVDMDKKLAAENLLKELSSCHGALIRQM
KQMVEIYIKLAELETKKEDTNKRIPLPREIRNICQLELVPVVTATIPVDPNCQYEEGSFP
HFNGLADSIMIMNGINAPKVIECIGSDGNNYRQLAKSGNDDLRQDAVMEQFFSLVNMFLQ
NHRDTSERRLRIRTYKVVPFTPSAGVVEWVNGTVPLAEYLLGSTRSGGAHGRYGTGDWTY
HQCRETMTNEKDKRKAFAKVCNNFRPVMHHFFFERFLQPADWFQSRLAYTRSVAASSMVG
YIVGLGDRHAMNILIDQETAEVVHIDLGVAFEQGLMLKTPERVPFRLTRDIIDGMGVTGV
EGVFRRSCEKTLSVMRANKEALLTIIEVFVHDPLYKWALSPLKALQRQKETDDTDSCLDD
SQEAYEGNKDAARAILRVKQKLDGYEDGEMRSVQGQVQQLIQDAVDADRLCQMFPGWGAW
L
NT seq 8286 nt NT seq  +upstreamnt  +downstreamnt
atggaatgtgttaacacatttctactgaaggatgggccaaatctgggatgcaaatctgtt
gatatccacaatgccattcaagattttatgttccattcctggccgatgacccatgatagg
gctttgaagagcttgttcatcacctatgcgaaggttcagctgaagcttgctagggctatc
cctgagattcttgaaaaacttcttgatgtcatcattaaggaattagaccatcattttaat
actggatcatctttagtatggtgtgaggcacctcgagatgagaaagctgggtccttgaga
tgtttccaggaagaattgatggatctatctgctactgtcttatatcaggcctgcaaatgc
acaccgaggacatcaaataatgagaaaaaattaaagacggagcatgttatgaccatcatc
atggatagcctgctgaaaggatctcttgtttggagcggttctatttattatcttattcac
aagtatgggtaccgagtggataaatccttgttgattagttggttcgaggcaacctgtaaa
ggtttgaaaagtgtattgagcaatacaaatgccctacggtttcaagattcactgctatgg
cttatcagggttctcaaggagttctctgcgctgctcgtgctggatgctaggaatgaaaca
ccatttttgttaacaaaaggcgagatgtcaaattttgaaggttattggcaagatacctgg
aattgtcttattcatgcacttccattgtttagtaccacagctcttgtcgctgattcagtt
ctgaggttgttgagtgaaatgatcatgcgggaccaagttcatgcatcatttgtgtcagaa
gatacatgggacctacaaatatttaaacaattaccatcatcgtcagctttgtacttcgtt
gcttgttacttttcaaaaataggcattcagggtgatttatccaattccatctttattcga
aagaatctgctaagatcaactttggagttagtgcactcaaagggattctctcttttgaat
gaacaaaatgttctgatgattcctgaaaccatttttgctctctgtgctggtttttcctcg
cctatgattaacttagcagatacgtcacaactgtttggtgaatgtaaagacatttccaag
ttgtaccgaaaggacgagagctggtctcacgaggaagaactaggttattctgtggaagct
ctatcagagatcaatcttgaaagtcctaccaaggtcatgtctgacaaatgcacccaggct
caccttcctcgtcatattcagcaacccttgttcctggagcttttggagtttaccaaagga
ttcatgtcaaatgaacagttcgagcaagtggacttacctaatcttgtatatgcttgtgcc
cttgtctgcaacctaattcattgttctctgttgtcaagggtcattgatgaaaaatcgtct
tttctgcaagctatgttggattatgtcaccaacatcataaaacataccgtgtcagtggtt
atgaaggaacatgctgaactttctaatggtcttaccaatctagggtcagcatttgataca
actggctcagtcttatcgtcatttaagagcttcatgtgttctccaatatttagtctgtgg
agagttaataataaagttagttctgtgcatgatgccactgaatttcttgatgaactctta
gtggctatatctcagctattttcccagctctctagtttgatgaacaattttgatggagat
aatcctagtaaaattttgccagtatctgttgtcagtttgtcagaggacataaatcctgac
ggcagaagtagtttagttgatatggatcttgatatgactggcactggtgaagtagatcct
gtcacagcaggtgggagtggaagtatgggtatctcaccacgccctttggagtacaagcta
caattagtctatattatttcaacctttttctccgtggtgccacttcatacatgggaagtc
ttgtacgacttagctgagaaagaggtcgatgtcaaggctggccaggctatcttgcttgaa
ctttgcacaaatatctctgcttcgtcaagaagtttatcttctgtgctcaatcttgtagtt
gatatgtgggacagaagtgcattctcactacttagctctgcagattgtttaacacatgtc
catgccctgataaggaatttgacagctaattgtgatgttgggcataatactgatggaaag
tcacaaggatttgaagtggcgcccaatgagaaccaggacatcctattaaatttagtaaac
agggctactgagatcagttccacagattggtttttccgcaccaggctgattaattgcatc
tctcagtttatttatctgtttcccgatgtcgctcaggacatgattggccacttgcttagc
atgctacatgatactgattatcgtgtcaggttgtatttggctcggaaaattgttgtgcta
ttccaagtatgggaaggacacagtgagttgtttcatgatgtttgctcaaatattggtgtc
aagatggtgcagttttcaaatgaaaatccagttaaagctagagaagtcttggctattggt
ccacagcctgttcctattattgaaactgccctcattacactagctcatttgtccttgcaa
agtgaggatgttgaagttgagtgcatattcatgatttctgctgttgctgctatagagcca
tctcagcgagaattagcttatgctctatttgattctgtctcaaagaggctcagttatgct
tcacgaagtaagtatttggaccaactcatagggccaattcttttccggtgggttgcttgt
gaggttagcctagtttcgcttgttgaggtggaagaaatgtttggctttaaatcggctgag
ccaaagaacttcattgaacattgctgcccatggttactttctttccttattctgaggggt
gatactgccgatcttaattggctatccaagattttatcgcaacctttgtctgctgttatc
aagagatactttgtcccgatctttggattgtgcattgctgccagatgtggctcagggcca
gagaaggacatatcagagactgtcttatgtgaatcccttttgcagcttggtgaaatttct
gagcctgaacgcgatgatctcattaaaaaacatatggtttccattgttggctttttgcta
tcagtttcatcttcttctcgtcagccagaaattccacacttttccaaggaggctgtggta
cactcggtgaaaacagttgttgatggatttatggaagcaatggatggtaatttggccgaa
acagttgttattgataaaattaacatattccgttcagacagggttttcaagttcctgttg
tcaatacatcagcaaattgcagatgctaaccatcctaggcatatgcgtcatcgcctttgt
gccattgaggttttgatagatgtacttggccacagagtggctctttacagcacttggttc
tatattatttgtatagtggggagttacatctggagacaaccattgcaaggtcaatgctgc
aatattttgtctaagttgctggttgctttcaattcaaactcttctactgaaactgttccg
gcgcttggcaagcagcttcagctcttagttccaaaattggtcacttgttgccttcgcaat
gagaaagaaggaaaatgtgctattgcagactcatcaagagttttatctctgcttcgtcaa
ttgacagtcgatgctgatccattgctttatgattacataagagatctggagccacttcct
agcttggattgcttaaaagatatacaagtgttccatgcttcactttccagttcctatgat
tcaagagatcagtttctaaagtttgttagcagggctcctcacttgccaccagatttgttt
ctgttgagtcttcgtatgcatcacaagaacttattatcaggagagatcatctgcagaggc
gatgcatctgtggataatgcagacacagttagttgttggcacagtgaccctgatgttgtt
tctgctgtatggactcttgttgacttttgtagctcatcgtttgtggccaatgaagcttca
tcggtgcttgctgattttatctctagggctggcatatctgatgtgcatcaagtgatattt
catgtgccgaatctttctgaaaaataccccatacaactggatatttccaaggataaattg
tactcgggctatggcatttctgatgatatcttggttggtcttctgaaacttttgaagact
tgtttgtctgacgattctgttgaaataatagatgttacttcacgaacactgaggggaatt
ctgtcaacggcaagtggcctcaatgctctgcaaagccttgattctcttgataggtcttta
ctgatggttcattcacgaggcataaactctcagttagttgaacagacacttttgggcatg
gaaaatgtttctggtgtttcacttgaagatcgggacctatggagaactgatggtcggtct
tacaagcaatggttatgtactttagtgggctcactaatttgtcattgtgatgacatcatc
ttgagactttgtaggagtcttgcttttctcaaagttgaggctgctgaaattttgcttgca
agtgctcttgtgaacattgcgggcaatttggattcaaatgctggcatctgcagattaatt
tcaactatggtggaggaaataatattttgtgattccaatcatttgatgaagtcagttcat
ctgtttttggatgcgctgaatgttgtcaggtcttattgtgttgcagaaaaagccaggggt
tgcccttcaaatgctctcaaggatggtagatctgtcagatccaaaagtcgatcaccaaca
acaaccccatcctcctcctggaagaaggtgtactggctgtcggttgattatcttgtagct
gccagagctgctaataggtgctcatgtgacttcgcaacaataatgtatgttgaactttgg
tgtgaggaaaaattcaatatgctactgttaggacctccagatttttcacatgaagagttg
ttgccgccacatatcggtctactgcttgatgcatttactcgcataaatgagctggacagc
atttatgggatcacactggccaatgagataagttcacaaatcattagatatgagcatgag
ggtgattggagtagtgctcttgaatatcatgatatacttgtaagatcaactcgaaaggag
aaccttagcagtttgcctgggacatcattgactggaccctctgatgcaccttctaaagct
gaaaagaagatgctgaactggcaaatgcacaaaggtctgatgaggtctttgcagaagact
ggatgtagtcatgtactcgatgtctattgccaaggtttaagcagccaaaaaagttgtctt
caagattcagaatttattgatatacagtatgaaactgcttggagagctggaaattgggat
ttctcctttcttgctccatactcttctcagccttctaccctttctcaaagttactgcctt
ttcaatcaaagtttgcacagttgcttaagagctctacagagtggtgattctgaggagttc
catgtgaagctttctaactccaagatgaatcttgtgctggctctttcaaatgctagcaag
gagagcacaaaatgcatccattctactgttctcaaactacagatgttagatcatcttact
atggtttgggacctacgttggaaattttgtcccaatcatacatcaaagtcttatgttgga
accaaggatttttctcccgttcctactgttcctacaaggatgcagttggagcttctgaat
aaagagtggacttcaatcctgtgtcagacagaacgtaattttgatcttttggaacctttt
ctagcattccggagtgctgtccttaaaatcttaggttgtgaagagcatctcagagaacat
ttatttcaatctgcttcagcactccggaagggagcaagattttctttggctgcggctgct
ttatatgaactcaaagaactttgttaccagatggaacatcaagctatgccaaaatcttat
ttcctatttaagcttgaagaagctaaactgctgagagctcaagggcagcatgatatggct
ataagtcttggcaaatacatcctaaagaaccatcctgataagaaggacatatcagatgtc
taccgattagtcggcaagtggttagctgaaacaagatcgagcaattcaagaactatcata
gatgactacctaaggcattctgtagatcttactgaatcccacaaaagctcagacaaaaag
tacaagtccaggcaatgccgaacatatttccatctagcgcattacacagatggcttattc
aaaagctatgaagaaagactttcatccaacgaatggcaagcagctctgcgattaaggaaa
tacaagactagggagctggagacactgattaaaagacttaaaagttcatcaaagagtgaa
aagactgattactcagtgaaaatccaagagttgcagagacaacttgcacttgacagagaa
gaggcagagaagattcaggatgaccgggacaaattcttaagtctagcacttcaggggtac
caacgctccctcgctgtcggtgggaaatatgatctacaagtggtcttccggttggtctct
ctatggtttagtcttttctcaagagagcaagttgtgaaagcaatgataaagacaacaaaa
gaggtccaaacctacaagttcataccattggtctatcaaattgcttctagacttggaagc
tcaaaagacgtgcatggctcatcgaacttccagaatgcattaagttctctcctgaagaaa
atggccattgatcatccatatcatacaatatttcagcttttggctctagcaaatggtgac
cgcgtcaaagacaggcaaaggagtagaagttcttttattgtagacatggacaagaagctt
gctgctgaaaatctgttaaaggaattatcttcttgtcatggagctttgattcgccagatg
aaacaaatggttgagatctacattaagttagctgaactagagaccaagaaggaggacact
aacaaaagaattccgctacctagggagatccgcaacatttgtcagcttgaacttgttcct
gttgtaactgctactattccagttgatcctaattgtcagtatgaagaaggttcctttcca
cattttaatgggctagcagattctattatgataatgaacggaattaatgctcctaaggtt
attgaatgtattggctctgatggtaacaactaccgccaacttgcgaaatctggaaatgat
gacctgcgacaagatgctgtgatggagcagtttttcagtctagtaaatatgttcttgcaa
aatcacagagatacttctgagaggagattgagaattcgcacatacaaggttgttcccttc
accccaagtgccggtgttgttgaatgggtaaacgggactgttcctcttgctgaatatctc
ttggggagtacaagaagtggtggagcacatggaagatatggaactggagactggacatat
caccaatgcagagagactatgacaaatgaaaaagacaagaggaaggcgtttgccaaagtt
tgcaacaacttcaggcctgtgatgcaccacttcttctttgagagattcttgcagcctgca
gattggttccaaagtagacttgcttacacaagaagtgtggcagcaagctcaatggtagga
tatattgtgggacttggtgatcgtcatgccatgaatattctcattgatcaggagacagct
gaggttgtacacatagatcttggtgttgcatttgaacagggtctcatgcttaaaactcct
gaacgggttccatttcgtctgacaagggacattatagatggcatgggagttaccggcgtt
gaaggtgtatttagaagatcttgtgagaaaaccctttcggtcatgagggcaaataaagaa
gcactgctcactattattgaagtcttcgtccatgatcctctgtataaatgggccctctca
ccactgaaagctttacagcgccaaaaggaaactgatgacacagactcgtgcttggatgac
tcacaagaggcttatgagggcaacaaggatgcagcccgagctatcctccgtgttaagcaa
aagctggatggatatgaagatggtgaaatgagaagtgtgcagggccaggtgcaacaactg
atacaggatgcggtagatgcagaccggttgtgccaaatgtttccagggtggggagcgtgg
ttgtaa

DBGET integrated database retrieval system