KEGG   Opitutaceae bacterium TAV5: OPIT5_02645Help
Entry
OPIT5_02645       CDS       T03683                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
obt  Opitutaceae bacterium TAV5
Pathway
obt00970  Aminoacyl-tRNA biosynthesis
obt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obt00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    OPIT5_02645
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:obt03029]
    OPIT5_02645
Enzymes [BR:obt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     OPIT5_02645
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     OPIT5_02645
Mitochondrial biogenesis [BR:obt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    OPIT5_02645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AHF89319
UniProt: W0IXY3
LinkDB All DBs
Position
495325..496806
Genome map
AA seq 493 aa AA seqDB search
MPATPLTYRTIADLSDALARKELSSVELTQAVIDRTAAVEPKVNAFNSYDPADALAQAAA
SDARRAAGHARGPLDGIPVAIKDVISVANQPLTASSKILANYVSPYDATVIQKLRHAGAV
IWGRLNLDELAMGSSTENSAFKTTSNPYDLDCVPGGSSGGSAAAVAAGEAIATLGSDTGG
SIRQPAALCNVVGLKPTYGLVSRYGLAAFASSLDQIGPFTRTVEDAALLLQAIAGHDPHD
STSCQVALPDYRAGLHRQSASSEAPRRLGIPKEYFGEGLDPEVGAAVEQAIAHYKKLGYE
IRDVSLPHTEHCLSVYYILSTAECSSNLARLDGIRYGYRSPNATGAVDIYSKTRAEGFGP
EVKRRVILGTYVLSSGYYDAYYLRAQKVRTLIRQDFLNAFGQVDAIVTPTSPTPAFRKGE
RSANPMAMYLSDIYTIGANLAGIPGISIPCGFTRAGLPIGLQLLGQPLKEADLLAIAHAY
DSVHDWHTRHPAL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgccggccacaccgctcacgtaccgcaccattgccgatctctccgacgccctcgcccgc
aaggaactttcttcggtcgaactcacgcaggccgtcatcgaccgtaccgctgccgtcgaa
ccaaaggtcaacgccttcaactcgtacgaccccgccgacgcgctcgcgcaagccgccgcc
tccgacgcccgccgcgccgccggccatgcccgtggcccgctcgacggcattcccgttgcc
atcaaggacgtcatttccgtcgccaaccaacccctgaccgcttcgagcaaaatcctcgcc
aactacgtttccccctacgacgccaccgtcattcaaaaactccgccacgccggcgccgtc
atctggggccgcctcaacctcgacgaactcgccatgggttcgtccacggaaaactccgcc
ttcaagaccaccagcaacccctacgacctcgactgcgtccccggcggctcttccggaggc
agcgccgccgccgtcgcggccggcgaagccatcgccaccctcggctccgacaccggcggc
tccatccgccagcccgccgccctctgcaacgtcgtcggactcaagcccacctacggcctc
gtctcccgctacggcctcgccgccttcgccagttcgctcgaccagatcggccccttcacc
cgcaccgtcgaagacgccgccctcctcctgcaagccatcgccggccacgacccgcacgac
tcgacctcctgccaggtcgcccttcccgactaccgcgccggcctccatcgccaatccgcc
tcctccgaggcgccccgccggctcggcatccccaaggaatatttcggtgaaggcctcgac
cctgaagtcggcgccgccgtcgagcaggccatcgctcactacaaaaaactcggctacgaa
atccgcgacgtttccctgcctcataccgagcattgcctgagtgtttattacatcctttcc
acggccgagtgttcctccaacctcgcccgcctcgacggcatccgctacggttaccgctcc
cccaacgccaccggtgccgttgacatctacagcaaaacccgggccgaaggttttggtccc
gaagtcaaacgccgtgtcatcctcggcacctacgtcctcagcagcggctactacgacgcc
tattacctccgcgcgcaaaaagtccgcaccctgatccgccaggatttcctgaacgccttc
gggcaagtcgacgccatcgtcacgcccacgagccccacgcctgcgttccgcaaaggcgag
cgctccgccaacccgatggccatgtatttgtccgacatctacacgatcggcgccaacctc
gccggcatccccggcatcagcatcccgtgcggtttcacccgggccggcctccccatcggc
ctgcaactcctcggccagccgctgaaagaagccgacctcctcgccatcgcccacgcctac
gactccgttcacgactggcacacccgccatcccgctctctga

DBGET integrated database retrieval system