KEGG   Opitutaceae bacterium TAV5: OPIT5_05755Help
Entry
OPIT5_05755       CDS       T03683                                 

Definition
(GenBank) heme ABC transporter ATPase
  KO
K15738  ABC transport system ATP-binding/permease protein
Organism
obt  Opitutaceae bacterium TAV5
Brite
KEGG Orthology (KO) [BR:obt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:obt02000]
    OPIT5_05755
Transporters [BR:obt02000]
 ABC Transporters, Eukaryotic Type
  Other subfamilies
   Other ABC transporters
    OPIT5_05755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_tran_CTD AAA_21 ABC_tran_Xtn SMC_N RsgA_GTPase AAA_16 AAA_22 AAA_23 AAA_29 MMR_HSR1 AAA_15 AAA TsaE NACHT AAA_24 RNA_helicase AAA_30 AAA_33 Zeta_toxin MeaB cobW MobB AAA_18 DLIC
Motif
Other DBs
NCBI-ProteinID: AHF89815
UniProt: W0IUP7
LinkDB All DBs
Position
1236689..1238650
Genome map
AA seq 653 aa AA seqDB search
MALLTLLDVSHAFGGPPVLDHINFQVDPGERVCLVGRNGAGKSTLMKLIAGDMKPDTGEI
FRQPGAHFARLTQEIPAEVGLPGSVHDFVAAGLRPASAHEEDWEQEIRLEQLLDRMQLPP
AAEVARLSGGLKRRVLLARALASAPDLLLLDEPTNHLDLASILWLEEFLQTEKIGLFFVT
HDRAFLRKLAGRIVELDRGVLTNWACPYDTFLVRRQERLEAEERQQAATDKKLAQEEEWS
RRQPSARRTKAVARLEQLAALRAERRNRRARTGTATLRVTTASESGVKVIDAENLSFAWP
PPPPAAGSSEFRVSGSELEETPVAGSPTLNSRLQTLNPAAEPPPPLLRDFTATIMRGDKI
GLIGPNGAGKTTFIKLLLGQLQPTGGTLKHGTQLEVVYLDQLRAQIDDAKSVADNVADGN
TTVTVAGKTKHVISYLQDFLFEPDRARTPARVLSGGERNRLLLARLFTRPANVLVLDEPT
NDLDAETLELLENLLVEFAGTLIVVSHDRAFLDEVVTSVYVFEGEGRVAEYVGGYTDWQA
ELARKPAGAGTPDQKSPASGSGAGPATAGTPPPGAARPRKLTNRERNELAALPARIEKLE
TEQAELTARLADPAFYQREPGAAGEVRARMAVIEEELATVFARWEELEAAATE
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctcaccttgctcgacgtttcccatgccttcggcggtccgccggttctcgac
cacatcaacttccaggtcgatccgggtgaacgcgtgtgcctcgtcgggcgcaacggcgcg
ggcaagtccacgctcatgaagctcatcgcgggcgacatgaaacccgacaccggcgaaatc
ttccgccagcccggcgcgcacttcgcccggctcacccaggaaattcccgccgaggtcggg
ctgcccggctccgtccacgattttgttgccgccgggctccgtcccgcctccgcgcacgag
gaggactgggagcaggaaatccgcctcgaacaactcctcgaccggatgcagctcccgccc
gccgccgaagtcgcccggctctccggcggactcaagcgtcgcgtgctcctcgcccgcgcg
ctcgccagcgcgcccgacctgctcctgctcgacgaaccgaccaaccatctcgacctcgcc
agcatcctctggctggaagaatttttgcagaccgagaaaatcggtctgtttttcgtcacc
cacgaccgcgccttcctccgcaagctcgccggccgcatcgtcgagctcgaccgcggcgtg
ctcaccaactgggcctgcccgtacgacacctttctcgtccgtcgccaggaacggctcgaa
gccgaagaacgccagcaggccgccaccgacaaaaaactggcgcaggaggaagaatggtcg
cgccgccagccgagcgcgcgccgcaccaaggccgtggcccgcctcgaacaactcgccgcc
ctccgcgccgaacgacgcaaccgccgcgcccgcaccggcaccgccaccctccgcgtgacc
acggcgagcgaatccggcgtcaaggtcatcgacgccgaaaacctgtcgtttgcctggccc
ccgccgccgcctgcggcggggagttcggagttcagggtttccggttcagagttggaagag
acgcccgtagccggttccccaaccctgaactccagactccaaaccctgaacccggcggcg
gagccgccgccgccgctcctgcgcgacttcaccgccaccatcatgcgcggcgacaagatc
ggcctcatcggccccaacggcgcgggcaagaccacgtttatcaaactgctcctcgggcag
ctccagccgaccgggggcacgctcaagcacggcacgcagctcgaggtcgtctatctcgac
cagctccgtgcgcaaatcgacgacgcaaaatccgtcgccgacaacgtggccgacggcaac
acgaccgtgaccgtcgcggggaagacgaagcacgtcatcagctacctccaggattttctc
ttcgagcccgaccgcgcgcgcactcccgcccgcgtgctttccggcggcgaacgcaaccgg
ctcctcctcgcgcgccttttcacccggccggccaacgtcctcgtgctcgacgaaccgacc
aacgacctcgatgccgaaacgctggagttgctggaaaacctgctcgtcgaatttgcgggc
acgctgatcgtggtaagccatgaccgcgcatttctggatgaggtggtgacgagcgtgtac
gtgttcgagggcgagggccgcgtcgcggaatacgtcggcggctacaccgactggcaggcc
gagctggcgcggaaacccgccggggcggggaccccggatcagaaatccccggcctcaggc
agcggggcaggtcccgcgacggcaggaactccgccgccgggagcggcgcgtccgcgcaag
ctcacgaaccgggaacgcaacgagctcgccgccctcccggcgcgtatcgagaagctggag
accgaacaggcggagctgactgcgagactggccgatccggcgttctaccagcgcgagccc
ggcgcggccggcgaggtgcgcgcgcggatggcggtgatcgaggaggagctggcgacagtg
tttgcgcgttgggaagagctggaagcggcggcgacggagtga

DBGET integrated database retrieval system