KEGG   Opitutaceae bacterium TAV5: OPIT5_12865Help
Entry
OPIT5_12865       CDS       T03683                                 

Definition
(GenBank) xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
obt  Opitutaceae bacterium TAV5
Pathway
obt00040  Pentose and glucuronate interconversions
obt00051  Fructose and mannose metabolism
obt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    OPIT5_12865
   00051 Fructose and mannose metabolism
    OPIT5_12865
Enzymes [BR:obt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     OPIT5_12865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AHF90968
UniProt: W0J1W1
LinkDB All DBs
Position
2951088..2952128
Genome map
AA seq 346 aa AA seqDB search
MKSNKYSVILGNLGNTCDRFLPTGYKSQPTKAEMIRQAASIEGLGGLELVGGWDVTPENA
REMHSLMSDHGLACVSIIPDFFSRSVWGSGSFCSRDANVRKLALEEGHRAAEVASLMGCP
LLNLWLGQDGYDYPLQSDFGSQRQWMLEGIRSLAGAWPALKFALEYKVKEPRVRSFHARA
ADTLLMARETDLPNVGVCIDVGHAFAAEENVAESAWLLNHYGNKLFHMHYNDNYGHWDDD
MIVGSVHLVHYIELYYWLRKIGYEGWHSMDQYPYREDGVRAVSESIAFLQSLERSLTTER
LAEIGALLAKGDATKSTRWMREFVFGRHEPAFAGEQAFAEAACAVR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtaataaatattctgtcatcctgggaaatctggggaacacctgtgatcgtttc
cttcctaccggttacaaatcgcaaccgacgaaggcggagatgatccggcaggccgcttcg
atcgaagggctgggaggactggaactggtcgggggctgggatgtgacccccgaaaacgcc
cgcgaaatgcattcgctgatgagcgatcacggtctggcctgcgtttcgatcataccggac
ttcttttcacggagtgtctgggggtcgggcagcttttgttcccgggatgcgaacgtgcgc
aagctcgcgctggaggaggggcaccgggcggccgaggttgcgagcctgatgggatgtccg
ttactcaacctgtggctggggcaggatggttatgattatccgttgcagtccgacttcgga
agccagcggcaatggatgctggaaggaatccgctccctggccggggcgtggccggcgttg
aaatttgccttggaatacaaggtcaaggagccgcgggtgcgttcgtttcatgctcgtgcg
gcggacacactgctgatggcccgggagacggacttgccaaacgtgggggtgtgcatcgac
gtggggcacgcttttgcggcggaggagaatgtcgccgagtcggcctggctgctcaaccac
tacggcaacaagctgtttcacatgcactacaatgacaactacggtcattgggacgacgat
atgatcgtcggcagtgtgcacctcgtgcactacatcgagctctactattggctccgcaag
atcggatatgagggctggcactccatggaccagtatccttatcgcgaagacggcgtgcgc
gcggtatccgagagcatcgcattcctgcaatcgctcgaacgaagcctgacaactgaacgg
ctggcggagatcggggcattgctggccaagggagacgccacgaaatcaacccgctggatg
cgcgagtttgtgtttggccgtcacgagcctgcttttgccggggagcaagcctttgccgag
gcggcctgcgctgttcggtag

DBGET integrated database retrieval system