KEGG   Opitutaceae bacterium TAV5: OPIT5_18105Help
Entry
OPIT5_18105       CDS       T03683                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
obt  Opitutaceae bacterium TAV5
Pathway
obt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
obt01100  Metabolic pathways
obt01110  Biosynthesis of secondary metabolites
obt01130  Biosynthesis of antibiotics
obt01230  Biosynthesis of amino acids
obt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:obt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OPIT5_18105
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OPIT5_18105
Enzymes [BR:obt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     OPIT5_18105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AHF91844
UniProt: W0J550
LinkDB All DBs
Position
4227416..4228483
Genome map
AA seq 355 aa AA seqDB search
MRKTSDINVVETRLLPSPAELVNEYPRSEAQSEFITRVRQEIHRIVFTADRRFLLVVGPC
SIHDTEAGLDYARRLAVLARDVADRVMVVMRVYFEKPRTTVGWKGLIMDPGLDGSHDIAR
GLRAARAFLREVVDLGLPTATELLDPITPQYIADLICWSAIGARTTESQIHRQMASGLSM
PLGFKNGTDGSLTTAINAIRAASQPQTFLGININGQSSAIVTAGNPNCHVVLRGGKAGPN
YDAAHVGEAVQALDKAGLVPAVMVDASHDNSSKKPERQPEVVREVVQQIVAGNHAIIGAM
VESNLEAGSQPFPQPRENLRYGVSITDGCIDWATTEALVREVHAALAPRFAKARG
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaacatccgatatcaacgtggttgaaacgcgcctcctgccgtcgccggccgag
ctcgtgaacgagtatccccgttccgaggcgcagtcggagtttatcacccgggtgcggcag
gagatccaccggatcgttttcacggcggaccgccgtttcctgctcgtggtgggcccgtgc
tcgattcacgacacggaggccgggctcgattacgcgcggcgcctggccgtgctggcccgg
gatgtggccgaccgggtgatggtcgtgatgcgcgtatacttcgaaaaaccgcgcacgacg
gtcggctggaaaggcctgatcatggacccggggctcgacggttcgcacgacatcgcccgc
ggcctgcgggcggcgcgggcgttcctgcgcgaggtggtcgacctcggcctgccgacggcc
acggagttgctcgacccgatcacgccgcagtacatcgcggacctgatctgctggtcggcg
atcggggcgcgcaccaccgaatcccagatccaccgccagatggcctcgggcctttcgatg
ccgctgggcttcaagaacggcacggacggctcgctgacgacggcgatcaacgccatccgc
gcggcgtcgcagccgcagacttttctcggcatcaacatcaacgggcagtcgtcggcgatc
gtcacggcgggcaatcccaactgccatgtggtgctgcgcggcggcaaggccgggcccaac
tacgacgccgcgcatgtgggcgaggccgtgcaggcgctcgacaaggcggggctcgtcccg
gccgtgatggtggatgcctcgcatgacaattcttccaaaaaaccggagcgccagcccgag
gtggtgcgcgaggtggtgcagcaaatcgtggcgggcaaccacgcgatcatcggcgcgatg
gtggagagcaatctcgaggccggcagccagcccttcccccagccgcgggaaaacctgcgt
tacggcgtgagcatcaccgacggctgtatcgactgggccacgaccgaggcgctggtccgc
gaggtccacgccgcgctggccccgcgctttgcgaaggcacgggggtga

DBGET integrated database retrieval system