KEGG   Opitutaceae bacterium TAV5: OPIT5_21375Help
Entry
OPIT5_21375       CDS       T03683                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
obt  Opitutaceae bacterium TAV5
Pathway
obt00564  Glycerophospholipid metabolism
obt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:obt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    OPIT5_21375
Enzymes [BR:obt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     OPIT5_21375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like GIDA Pyr_redox_2 NAD_binding_8 Pyr_redox Thi4 Pyr_redox_3 3HCDH_N FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AHF92422
UniProt: W0J1T8
LinkDB All DBs
Position
complement(5043614..5045233)
Genome map
AA seq 539 aa AA seqDB search
MDRNEHLNRLRAGEIFDVIVIGGGATGLGAAVDAAARGHRVALIEQDDFAKGTSSRSTKL
VHGGVRYLKQGNVKLVREALHERGRLAKNAPHLVHNMEFVIPNYSRFDQVFYGVGMKVYD
RLAGRLGLGHSLVLSRDEAIRRLPTVETHGLKGGVLYHDGQFDDSRLAINLARTAAGLGA
VVVNYCKCTGFVKGGGGRIEGVRVRDEEAEAAGGGAEFEVHAKAVINATGVFVDGLRKQA
EPAATDLVTVSQGIHLVLPKKFLPGNSALMVPKTADGRVLFAVPWHDCVVVGTTDTPRPA
ASLEPRALDEEYEFVMTHAQKYLALDPADSDVLSVFAGLRPLVKSGHGGSTAALSRDHTI
VIGKTGLVTITGGKWTTYRRMAEDVIDHVEKLAGLPEHACATKELKIHGWLEDGGATLRE
RNLRVYGADAEGVRALIARRPDLAAPLHPALPYQQAEVVWHAREEMARTVEDVLARRTRA
LLLDARASIEAAGRVAGLLAGELGRDEAWQRKQCETYARLAAGYTKAGVLPGDGVRVAA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtaacgaacacctgaaccgcctgcgggcaggagagatttttgatgtgatcgtc
atcggcggcggcgccaccgggctgggagcggccgtcgatgcggcggcgcgcggacatcgc
gtggcgctgatcgagcaggacgacttcgccaagggcacgtcgagccgctcgaccaagctc
gtccacggcggcgtgcgttatctgaaacagggcaacgtcaaactcgttcgcgaggcgctg
cacgagcgcggacgcctggcgaaaaatgcgccgcatctggtgcacaatatggaattcgta
atccccaactactcgcgcttcgaccaggtattttatggggtgggcatgaaggtttatgac
cggctggcggggcggctcggcctcgggcattcgctggtcctgagccgcgacgaggcgata
cgccggctgccgaccgtggaaacacacgggctcaagggcggcgtgctgtatcacgacggg
caattcgacgactcccgcctggcgatcaacctcgcgcggacagcggccgggctcggcgcg
gtggtggtcaattactgcaagtgcaccggtttcgtaaaaggcgggggcggccggatcgag
ggcgtgcgcgtgcgcgatgaggaggcagaggccgccgggggcggcgcggaattcgaagtc
cacgccaaagccgtcatcaacgccaccggagtatttgttgacggactacgcaagcaggcc
gaaccggcggcgaccgatctggtgacggtgagccagggcatccaccttgtcctccccaaa
aaattcctgcccggcaactcggccttgatggtgccgaagacggcggacggacgcgtgctg
ttcgccgtgccgtggcatgattgcgtggtcgtcggcacgacggatacaccgcgccccgcc
gcaagcctggagccccgggcgctggacgaggagtacgagtttgtgatgactcacgcccaa
aagtacctcgctctcgatccggcggattcggatgtgctgagcgtgtttgccggactgcgc
ccgttggtgaagtcgggccatggaggaagcacggcggcgttgtcgcgcgatcataccatc
gtgatcggaaaaaccggcctggtcaccatcaccggcggcaaatggacgacgtaccggcgc
atggccgaggatgtgatcgatcatgtcgaaaaactcgccggcctccccgaacacgcatgc
gcgacaaaagagctgaaaatccacggctggctggaggatggcggcgccacccttcgcgaa
cgcaacctgcgcgtttacggcgccgacgcagaaggcgtgcgggcattgatcgcccgacgt
cccgacctggcggctcccctccatcctgccttgccgtaccaacaggcggaagtcgtgtgg
cacgctcgcgaagagatggcgcgcacggtcgaggacgtgctggcgcgacgcacccgggcg
ttgttgctcgatgcccgcgcgtccatcgaggctgccggtcgcgtagccggtttgctggcc
ggcgaactgggtcgcgacgaagcctggcagcggaagcagtgcgagacgtatgcaaggctg
gcggcgggttataccaaggcaggcgttttaccgggcgacggcgtccgggttgccgcctga

DBGET integrated database retrieval system