KEGG   Opitutaceae bacterium TAV5: OPIT5_23600Help
Entry
OPIT5_23600       CDS       T03683                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
obt  Opitutaceae bacterium TAV5
Pathway
obt00620  Pyruvate metabolism
obt00680  Methane metabolism
obt01100  Metabolic pathways
obt01120  Microbial metabolism in diverse environments
obt01200  Carbon metabolism
Module
obt_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:obt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OPIT5_23600
  Energy metabolism
   00680 Methane metabolism
    OPIT5_23600
Enzymes [BR:obt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     OPIT5_23600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AHF92744
UniProt: W0J7R5
LinkDB All DBs
Position
5564330..5567302
Genome map
AA seq 990 aa AA seqDB search
MARRTLAAASASTTSAFSESEKPRRKTSSALGDLARLRDEVRFLGSVLGEVIREVEGEAT
FATVERLRTLAKARRGRAGGGRDSRHARESHAVRDGAGDQLDKAVAALTPVEAFNQAMAF
TLYFELVNLAEENFRVQLLRLRRAERSANPAAPAQRESFDAALAELRASGVGPAELQELL
DRIGIELVFTAHPTESKRRTLLTKLQRLALILRQRNPQATADTAGLAAPSPASASDGVRD
PESVAKIRREVASLWLTDRSRVERPGVNDEARTGLWYFNTTLYDVLPRLQADLERALSLH
YPGVRAPSRWLTFGSWIGGDRDGNPNVTAAVSAGILVLHRRLAVEKLAAATRELSRTLTV
SDRRDAVTPELRRLLRENRHLSPHVDELGSRYPHEPYRLLLAGLGARLAKAAEEGRDGTT
LLGGPVADESCLREDTPREVFGAIRRSLEAGRGALLAEGELKDAAHVLDVFGLHTARLDI
RQHSGPHEAAVAELLEVPGVAGEGEGAAAAPVKNYARLDEAARRQVLARALATAKPLDAL
QRSELSAATRNVLDPLVLAALTSVKFGSGALGIYIISMTDDVSDVLEVALIMRLAGADLP
IAPLFETLDDLNRAPDILAQLFAHPAYAGLLEARARHQHVMLGYSDSNKDCGYLTANWAL
YQAQETIVAACQASGVRVTLFHGRGGSIARGGGPAARAILAQPAGLRDGGIRITEQGEVL
STRYHDRDLAHRILEQMAYGVLLGAHAARNVQPPAAAWVQAMETMSEAGFAAYRKLVHDD
PEFLQFWKQATPIDEISNLKLGSRPSYRRATQSVSDLRAIPWVFSWMQSRFNFPGWYGLG
SALEAVLRRGAAGRKLLRTMHAGWPFFRTLIDNAELTMRKADMGIARLYASLVEDEGVRE
RMLRALADEFARAERAILAITGRKQLLAREPVLLRSVELRNPYIDPLNYLQVEMLRRLRA
GGLSKADEEAVRAVVELTINGISGGLKNTG
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
atggcccgccgcacccttgccgccgcttccgcttcaacaacatccgcattttccgaatct
gaaaaaccgcgccggaaaacgtcctccgctctcggcgacctcgcccgcctgcgcgacgag
gtccggtttctcggctccgtcctcggggaagtgatccgcgaggtggagggcgaggcgacg
ttcgccaccgtcgaacgcctgcgcaccctcgccaaggcccgccgcggccgggccggcggc
ggacgcgattcacgccacgcgcgcgaatcgcacgcggtccgtgatggagccggcgaccag
cttgacaaggccgtcgccgcgctcacgccggtggaggccttcaaccaggcgatggccttc
acgctgtacttcgagctggtgaacctcgccgaggaaaatttccgcgtgcaactcctccgc
ctccgccgcgccgagcggtcggcgaatcccgcggcgccggcgcaacgcgaatcgttcgac
gccgccctcgccgaactccgggcgagcggcgtcggtccggccgagttgcaggaactgctc
gaccggatcggcatcgagctggtgttcaccgcgcaccccaccgaatcgaaacgccgcacg
ctgctcaccaagttgcagcgcctggcgctcatcctgcgccagcgcaacccgcaggcaacg
gccgatacggccggccttgccgccccgtcaccggcgtccgcgtccgatggcgtccgcgat
ccggaaagcgtcgccaaaatccgccgcgaggtcgcctcgctctggctgaccgaccgcagc
cgcgtggagcgccccggcgtcaacgacgaggcgcgcaccggcctctggtatttcaacacc
acgctctacgatgtgctgccgcgcctccaggccgatctcgagcgcgcgctgtcgctgcac
taccccggcgtgcgcgcgccgtcgcgctggttgacgttcggctcgtggatcggcggcgac
cgcgacggcaaccccaacgtcacggcggcggtgtcggccgggattcttgtcctgcatcgc
cggctggcagtcgaaaaactggcggcggccacccgcgagctctcgcgcacgctgaccgtt
tccgaccggcgcgacgccgtcacgccggagctgcgccgcctgctgcgcgagaaccgccac
ctctctccgcacgtcgatgaactcggcagccggtatccgcacgagccctaccggctcctg
ctcgccgggctcggcgcgcggctggcgaaagcggccgaggaaggccgcgacggcaccacc
ctgctcggcggaccggtcgcggacgaatcctgcctgcgcgaggacacgccccgcgaggtg
ttcggcgcgatccgccgcagcctcgaagccggacgcggggcgctcctggccgaaggtgaa
ctcaaggacgcggcgcacgtgctggacgttttcggcctgcacacggcgcggctcgatatc
cgccagcattccggcccgcacgaggcggcggtggcggagctgctcgaagtgccgggcgtg
gccggggaaggggagggcgcggctgcggctccggtaaaaaattacgcccggctcgacgag
gcggcgcgccgccaggtgctggcgcgggcgctcgcgacggccaagccgctggacgccctg
caacggtccgaactctccgccgccacgcgcaatgtcctcgatccgctcgtgctggcggcg
ctcacctcggtcaagttcggctccggcgcgctcggtatctatatcatcagcatgacggac
gatgtttccgatgtgctcgaagtggcgctgatcatgcgcctggccggcgcggacctgccg
atcgccccgctgttcgaaacgctcgacgacctcaaccgcgctcccgacatcctcgcgcag
cttttcgcgcacccggcctacgccggcctgctggaggcgcgcgcgcggcaccagcacgtg
atgctcggctactccgattccaacaaggactgcggctacctcaccgccaactgggcgctc
taccaggcgcaggaaaccatcgtcgccgcctgccaggccagcggcgtgcgggtgacgctc
tttcacggacgcggcggcagcatcgcccgcggcggcggcccggcggcgcgcgccatcctc
gcccagcccgccggcctgcgcgatggcggcatccgcattaccgagcagggcgaagtgctc
tccacgcgttatcacgaccgcgacctcgcccaccgcatcctcgaacagatggcctacggc
gtgctccttggcgcgcacgccgcccgcaacgtgcagccgccggccgcggcgtgggtgcag
gccatggaaacgatgagcgaagccggtttcgcggcctacaggaaactcgtccatgacgac
cccgagttcttgcagttctggaaacaggccacgccgatcgacgagatcagcaacctgaag
ctcggctcgcgtcccagctaccggcgcgccacgcaaagcgtttccgacctgcgcgccatt
ccctgggtgttttcctggatgcagagccgcttcaatttccccggctggtacgggctcggc
tcggcgctcgaggcggtgttgcggcgcggcgcggccggcaggaaattgctgcgcacgatg
cacgccggctggccgtttttccggacgttgatcgacaacgccgaactgaccatgcgcaag
gccgacatgggcatcgcccggctctacgcctcgctggtcgaggatgaaggcgtgcgcgag
cggatgctgcgggcgcttgccgacgagtttgcgcgcgccgagcgggcgatcctcgccatc
acgggccgcaagcagttgctggcgcgcgagccggtgctgctgcgttcggtcgagctgcgc
aatccctacatcgacccgctcaattacctgcaggtggagatgcttcgccgtctccgcgcc
ggcggcctgtcgaaggcggacgaggaggccgtgcgcgccgtggtcgagctgacgatcaat
ggcatctcgggcgggctgaaaaacaccggatga

DBGET integrated database retrieval system