KEGG   Opitutaceae bacterium TAV5: OPIT5_25850Help
Entry
OPIT5_25850       CDS       T03683                                 

Definition
(GenBank) molecular chaperone GroES
Organism
obt  Opitutaceae bacterium TAV5
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Pyr_redox Pyr_redox_2 AdoHcyase_NAD HI0933_like Pyr_redox_3 ADH_N_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AHF93130
UniProt: W0J436
LinkDB All DBs
Position
6101235..6102251
Genome map
AA seq 338 aa AA seqDB search
MKAAYYEGNKTFRVADAPAIPPAPGEVRLKVAYVGICGTDVHIYHGHMDQRVKIPQIIGH
EMSGTIAEVGPGVTGFAVGDSVVVRPLDNRAETPADRGNSHICRNLKFIGIDSPGGFQTY
WNVPAFAVHKAPPATDLKLAALAEPLAVACHDVRLGGVKPGELAVVIGGGPIGILVALVA
RAAGAQVIISEVNELRLAFARSLGFEAHSPLATDLPALCREKSGDAGADIVFEVSGAKSA
AATMTDLLAIRGRIVVVAIYPKPVEINLHQFFWKELKLIGARVYEREDYEKALALIASRE
LPLEKLVTRVEPLTRIQAAFDNLGSTPDAMKILIDCQA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgcttactacgaaggtaacaaaacattccgcgtcgccgatgctcccgccatt
ccgccggcccccggagaagtccgcctcaaggtcgcctacgtcggcatctgcggcaccgac
gtccacatctatcacgggcacatggaccagcgcgtcaaaatacctcaaatcatcggtcac
gagatgtccggcaccatcgccgaggtcggccccggcgtcaccggcttcgccgtcggcgat
tctgttgttgtccgcccgctcgacaatcgcgccgaaacgcccgccgaccgcggcaacagc
cacatctgccgcaacctgaaattcatcggcatcgactcgcccggcggtttccagacgtac
tggaatgttcccgctttcgccgtccacaaggctccgcctgcgaccgatctcaagctcgcc
gcgctggccgaaccgctcgccgtcgcctgccacgacgtgcgtctcggcggcgtcaagccc
ggcgaactcgccgtcgtcatcggcggcggccccatcggcatcctcgtggcgctcgtcgcc
cgcgccgccggtgcgcaggtcatcatcagcgaagtcaacgaactccggctcgccttcgcc
cgctcgctcggcttcgaggcgcacagcccgctcgcgaccgacctgcccgcgctttgccgc
gagaaaagcggcgacgccggggccgacatcgtttttgaagtgtccggcgcgaaatccgcc
gccgccaccatgaccgacctcctcgccatccgcggccgcatcgtcgtcgtggcgatctac
cccaaaccggttgaaatcaacctccaccagtttttctggaaggaactgaaactcatcggc
gcccgggtgtatgaacgtgaggactacgaaaaagccctcgccctgatcgccagccgcgag
ctcccgctcgaaaaactcgtcacccgcgtcgaaccgctcacccgcatccaggcggccttc
gacaacctcggcagcacgcccgatgcgatgaaaatcctcatcgactgccaggcgtaa

DBGET integrated database retrieval system