KEGG   Opitutaceae bacterium TAV5: OPIT5_28625Help
Entry
OPIT5_28625       CDS       T03683                                 

Definition
(GenBank) glycoside hydrolase family 2
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
obt  Opitutaceae bacterium TAV5
Pathway
obt00052  Galactose metabolism
obt00511  Other glycan degradation
obt00600  Sphingolipid metabolism
obt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    OPIT5_28625
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    OPIT5_28625
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    OPIT5_28625
Enzymes [BR:obt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     OPIT5_28625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4982 Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: AHF93566
UniProt: W0J9X2
LinkDB All DBs
Position
6802549..6805068
Genome map
AA seq 839 aa AA seqDB search
MSTSFASSLLPGNITGASPRHRLLFNEGWQFRPPGYSNSTDGWLTLDLPHDWGVESGFDI
SLPGETGKLRWWGEAWYRKTLRLEPGDEDRLVSLEIEGAMANATVWVNGQRAGGWAYGYT
SFHVELTPHLDHDGPDNLIAIHLDNPPDSSRWYPGGGLYRNVWLHKTGRIHVAPDSPVVT
TRELAADHGRASLDVSLEISNTTAEPVTVCVRVDLHPLADTGEKSTHPVTEISSPFLELP
AQAAASHSMLAEITAPRLWTLHTEQSAPPGLYVAVVTVEDAKTGALLDRIETTFGIRTAR
FDPNTGFHLNHSAGPTRIQGVCLHHDLGPLGAAAHPGAIARQLTLLRELGCNAIRCAHNP
PAPSLLDLCDRMGFLVMDELCDAWRIAKKPNGYQTLFDDWVERDLRAMVRRDRHHPSVIL
WSIGNEIPEQTSSDGPALSARLAGIVREEDPERRPVTGGMNIPESGFNGWQRAYDVFGYN
YKPHLYSAFREANPGIPLIGAETASTVSTRGEYVFPVTDDPAGGIVAPPACQVSSYDLYA
PHWATTPDIEFAAQDAHAPAVAGEFVWTGFDYLGEPTPFNDDPSNLLNASDPATRAAIAA
ALDQLSRSGSPLPARSSYFGIFDLCGFPKDRYYLYQARWRPDLPMAHILPHWDWPGRIGQ
ITPVHVYTSGDEAELFLNGRSLGVRRRGPYDYRLRWDDVIYEPGELRVVVRKHGAPWAET
ARHTTGPAARIELQADSGRENGHLVFVTARITDALGQLSPQANHPLHFALSADAPASLVA
TDNGDPTRLVPFRSPTCDAFNGLALAIFRMRSPAESSVPFSLRVSSPGLAEATLTFPGR
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctccttcgcatcgtccttgttgcccggaaacatcacgggagcttcgcctcgc
catcgtcttctcttcaacgagggctggcagttccgacctcctggttattccaattcgaca
gacggctggctcacgcttgatctcccgcacgactggggtgtcgagtccggcttcgacatc
tcgttgcccggcgagaccgggaagctccgctggtggggcgaggcgtggtatcggaaaacg
cttcgcctcgaaccgggtgatgaagaccgcctcgtctcactcgaaatcgaaggcgcgatg
gccaatgccaccgtttgggtcaacgggcagcgtgccggtggatgggcgtatggatacacg
agcttccacgtcgagctcacgccgcatctcgaccatgacggcccggacaatctcatcgcc
atccatctcgacaatccgcccgattcctcgcgctggtatcccggtggcggactgtatcgc
aacgtctggctccacaagaccggacgcatccatgtggcgccggattctccggtcgtcacc
acgcgcgagctcgccgccgaccatggcagggcgagtctcgacgtttcattggaaatttca
aatacaacggcggagcccgttacggtctgcgttcgagtcgatttgcacccgttggcagat
accggagaaaaaagcacgcatccggtaaccgaaatttcatccccctttcttgagcttcct
gcacaagcggcggcgtctcactcgatgctggcggaaatcactgcgccgcgactttggact
cttcacaccgaacaatccgctccgccaggtttgtacgtggccgtggttacggtggaagac
gcgaaaaccggtgcgttgctcgaccgcatcgagaccacctttggcattcgcaccgcacgc
ttcgatccgaatacgggtttccacctcaaccattccgccgggcccacgcgcattcagggg
gtttgcctgcatcacgatctcgggccgcttggtgcagcggcgcatcccggtgccattgca
cgtcagctcacgcttctgcgcgaactcggttgcaatgccatccgctgtgcacacaacccg
cccgcgccttcgctcctcgatctttgcgaccgcatggggttccttgtcatggatgagttg
tgcgacgcctggcgcatcgccaaaaagccgaatggataccagaccctgttcgacgattgg
gtggaacgcgacttgcgggcgatggtgcgacgcgaccggcatcatccgagcgtgattctc
tggagcattggcaacgaaatccccgagcagacctcgtccgacggtcccgcgctctccgcc
cgcctggccgggatcgtgcgcgaggaagaccccgaacgccgtccggtgaccggcggcatg
aacattcccgagtcgggtttcaacggctggcagcgggcgtatgatgtctttggctacaac
tacaagccgcacctttactccgcattccgcgaggccaatcccggcattccgctgatcggg
gcagagaccgcctccaccgtgagcacgcgcggcgaatatgtgtttcccgtcacggatgat
ccggcgggaggcatcgtcgctccgcccgcctgtcaggtcagttcctacgatctttatgcg
cctcattgggcgacgacgcccgatatcgaatttgcggcacaggacgctcatgcgcctgcc
gtcgccggcgagtttgtatggaccggcttcgattacctcggcgaaccgacgccgttcaac
gacgacccgagcaatctcctcaacgcgtccgatccggcgacgcgtgccgccatcgccgct
gcgcttgatcaactctcccgctccggctccccgctcccggcacgcagttcctacttcggc
atttttgacctctgcggtttcccgaaggatcgctattatctttaccaggcccgctggcgt
cctgatctgccgatggcgcacatcctgccgcattgggactggccggggcgcatcggccag
atcaccccggtccatgtttacaccagcggcgacgaagccgaattgtttctcaacggccgc
tcgctcggcgtccgccgtcgcggtccgtacgattaccggctccgctgggacgatgtaatt
tacgagcccggcgaactccgcgtcgttgtcagaaagcacggtgcaccctgggccgaaacc
gcccggcatacgaccggcccggctgcgcgtatcgagttgcaggccgactccggccgtgaa
aacggtcatctcgttttcgtgaccgcacgcatcaccgatgcactggggcaactttcgccg
caggcaaaccacccgctccacttcgcgctctccgccgatgcgcccgcgagtcttgtcgcc
acggacaacggcgaccccacgcgcctcgttcccttccggtccccgacctgcgacgccttc
aacggactcgccctggccatttttcgtatgcgttcgccggcagagtcatccgttccattt
tcgctccgtgtcagctctcccggtctggccgaagccacgctcacctttcccggcaggtga

DBGET integrated database retrieval system