KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_5247Help
Entry
OCAR_5247         CDS       T00783                                 

Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
oca00473  D-Alanine metabolism
oca00550  Peptidoglycan biosynthesis
oca01100  Metabolic pathways
oca01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:oca00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    OCAR_5247
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OCAR_5247
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    OCAR_5247
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:oca01011]
    OCAR_5247
Enzymes [BR:oca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     OCAR_5247
Peptidoglycan biosynthesis and degradation proteins [BR:oca01011]
 Precursor biosynthesis
  Amino acid ligase
   OCAR_5247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 GARS_A CPSase_L_D2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACI92379
UniProt: B6JB38
LinkDB All DBs
Position
1223978..1224904
Genome map
AA seq 308 aa AA seqDB search
MTALQHVAVLMGGWSSEREVSLRSGAACAAALERKGYRVTRIDVQRDIATVLQNLKPDVA
LVMLHGKPGEDGTIQGVLETLGIPYSHSGVLSSSLAMRKDLAKTVMATAGVPVAEGLTLT
RAEIAKAHVMAPPYVIKPVADGSSVGVFIVTEDQAHPPQELFRDDWPHGEELLVEKYIAG
RELTCAVIKGEASDVIEIVPLLKFYDYEAKYSKGASKHVLPAPVLPFVYQEVRRLTLAAH
GALGCRGVSRADFRYDDRIEGTGGLVCLEVNTQPGMTETSLVPELAGYAGVAFDELVQWM
VEDASLDR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacagcccttcaacacgttgccgtcctgatgggcggatggtcttccgaacgcgaggtc
tcgctgcgctcgggcgcggcctgcgccgcggcgctggagcgcaagggctatcgcgtgacg
cgcatcgacgtgcagcgcgacatcgcaaccgttctgcaaaatctcaagccggacgtcgcg
ctggtgatgctgcatggaaagccgggcgaggacggcaccattcagggcgtgctggaaacg
ctcggcattccctacagccattccggcgtgctctcgtcctcgcttgcgatgcgcaaggac
ctcgccaagacggtgatggcgaccgcgggcgtgccggtcgcggaaggcctgacgctgacg
cgcgcggaaattgcgaaggcgcatgtgatggcgccgccttacgtcatcaaaccggtggcg
gacggctcgagcgtcggggttttcatcgtcaccgaggatcaggcccacccgccgcaggag
cttttccgggacgactggcctcacggcgaggagcttctggtcgaaaaatacatcgccggg
cgtgaactcacctgcgccgtcatcaagggcgaggcgagcgacgtgatcgagatcgttcct
ctgttaaaattttatgattacgaggcaaagtattcaaaaggcgcgtcaaaacacgttctg
cccgcacctgttttaccatttgtttaccaggaagtccgaaggttgacgctggccgcgcat
ggggcgcttggctgtcggggagtaagtcgggcggatttccgttacgacgatcgcatcgag
gggacgggtggtctcgtctgtctcgaggtgaatacccaacccggcatgaccgagacgtca
cttgttccagagcttgcaggatatgcgggcgttgcatttgacgagttggttcaatggatg
gtggaggacgcctctctcgatcggtga

DBGET integrated database retrieval system