KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_6680Help
Entry
OCAR_6680         CDS       T00783                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
oca00564  Glycerophospholipid metabolism
oca01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    OCAR_6680
Enzymes [BR:oca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     OCAR_6680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C P_proprotein Pyr_redox_2 Pyr_redox FAD_oxidored 3HCDH_N NAD_binding_8 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ACI93791
LinkDB All DBs
Position
complement(2619968..2621509)
Genome map
AA seq 513 aa AA seqDB search
MLIPSPAGMTLDHIYDLAIIGGGVNGCGIARDAAGRGYSVYLCEMNDLASGTSSWSSKLI
HGGLRYLEFYEFRLVREALIEREVLWGIAPHIIAPQRFVLPHHDGLRPAWLLRLGLFLYD
HLGGRRRLPPARTLNLRRDIAGKPLKPGFKTGFSYSDCTVDDARLVVLNAQDAVARGATI
ATQTKAIRAERGDGVWQLEVEDATQARHTVKTRIVVNAGGPWVQDILTARVGVEATAHVR
LVQGSHIVVPRLYDNNYAYTFQHADGRVIFVIPYQRDFTLIGTTDRDYEGDPAAVRATQE
EIDYLCAAASEYLATPVLPSDVVWSYSGVRPLYDDHASEARTATRDYMFELDAPEGLPVL
SVFGGKITTYRKLAEHALDKLSPYLRSAGKPWTADTPLPGGDFPMGEVDMLVQRLLREYP
FLSQRHANRLAHAYGTQAERVLGRAASFADLGRDFGHTLTEREVRYLMAHEFARTAEDVV
WRRSKLGLWLSREEIAALEAWMAAQSNLGAPAH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
ttgctgatcccctcgccagcaggaatgaccttggatcatatctacgatctcgcgatcatc
ggtggtggcgtcaacggttgcggcattgcgcgtgatgcggcggggcggggctattcggtc
tatttgtgcgagatgaacgatctcgcgagcggcacctcgtcatggtcgagcaagctcatt
cacggcggcttgcgttacctcgaattctatgaattccgtctggtgcgcgaggcgctgatc
gagcgcgaggtgctgtggggcatcgcgcctcacatcatcgcgccgcaacgcttcgtgctg
ccgcatcatgatggcttgcggccggcatggcttctgcggctcgggctttttctctacgat
catctcggcggtcgccgccgtctgcctcctgcacgcacgctgaatctgcgccgcgatatt
gcaggtaagccgctgaagccgggctttaaaacgggcttttcctattccgattgcacggtg
gacgatgcgcgactcgtcgtgcttaacgcgcaggatgcagttgcacgcggcgcgaccatc
gcgacacaaaccaaggcaatccgcgcagagcggggcgacggcgtatggcagcttgaggtc
gaagacgccacacaagcgcgtcacaccgtcaagacccgcattgtggtgaatgccggcggc
ccctgggtgcaggatattctcaccgcgcgtgtcggcgtcgaagcgacagcccacgtccgc
ctcgtgcagggctcgcacatcgtggtgccgcggctttacgataacaactatgcctatacg
ttccagcacgccgacgggcgagtgatcttcgtcattccctaccagcgcgatttcacgctg
atcggcacgacggatcgcgattatgagggagaccccgcggcagtccgcgcgacgcaagag
gagattgattatctctgtgccgctgcaagcgaatatctcgcaacgcccgtcttgccgtcc
gatgtggtgtggagctattccggcgtgcggccgctttacgatgaccatgcaagcgaggca
cgcaccgccacgcgcgactatatgttcgagcttgatgcgccggaggggctgcccgttctc
tcggtgttcggcggcaagatcacgacctatcgcaagcttgccgaacatgcgctggacaag
ctgtcgccttacctccgcagtgcaggcaagccgtggacggcggatacgccgctaccgggt
ggcgattttccgatgggcgaagtcgatatgctcgtgcagcgcctcttgcgggaatacccg
ttcctgtcgcaacgccacgccaatcgactcgcacatgcttatggcacgcaggccgagcgt
gttctcggtcgggcagcaagtttcgccgatctcggccgagatttcggtcataccctgacc
gagcgcgaggtgcgctatctgatggcgcatgagtttgcgagaacggcggaagatgtcgta
tggcgacgttccaagcttggcctgtggctgtcgcgcgaagaaattgcagcgcttgaggct
tggatggcggcgcaatcaaaccttggtgcgcccgcgcattga

DBGET integrated database retrieval system