KEGG   Oceanimonas sp. GK1: GU3_03000Help
Entry
GU3_03000         CDS       T01667                                 

Definition
(GenBank) maleylpyruvate isomerase
  KO
K01801  maleylpyruvate isomerase [EC:5.2.1.4]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00350  Tyrosine metabolism
oce01100  Metabolic pathways
oce01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:oce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    GU3_03000
Enzymes [BR:oce01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.4  maleylpyruvate isomerase
     GU3_03000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C_2 GST_C GST_C_6
Motif
Other DBs
NCBI-ProteinID: AEY00357
UniProt: H2FZI7
LinkDB All DBs
Position
647853..648494
Genome map
AA seq 213 aa AA seqDB search
MQLYSFFNSSTSYRARIALALKGLDYDYQGVNIRVGEQRADQYRALNPCQSVPLLVEDDG
TALSQSLAIIDYLDATHPEPRLLPAEPLARARVLELANAIACDMHPVNNLRILGYLKNKL
GVTEEQKTEWYHHWVAEGFTAVEALLERHGHGPYCFGEAPTLADCCLVPQVANAERMGCD
LSPYPRVMAVYAHCQQQPAFQQAAPSRQPDFIA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcagctttacagttttttcaacagttccacctcttaccgggcgcgtatcgccctggcc
ctgaagggcctggactacgactaccagggagtgaacattcgcgtgggtgagcaacgggcc
gaccagtaccgggcgctgaatccctgccagagcgtgccgctgctggtggaggacgatggc
accgccctgagccagtcgctggcgatcatcgactacctggacgccacccacccggagccc
cggctgctgcccgccgagcccctggcccgggcccgggtgctggagctggccaacgccatt
gcctgcgacatgcacccggtcaacaacctgcgcattctgggttacctgaagaacaagctg
ggggtgaccgaggagcagaaaacagagtggtaccaccactgggtggccgaagggtttacc
gcggtggaagccctgcttgaacgccatggccacggcccctactgctttggcgaggcgccc
accctggccgactgctgcctggtgccccaggtggccaacgccgagcgcatgggctgcgat
ctgagcccttaccccagggtgatggcggtgtatgcccactgccagcaacagccggctttt
cagcaggccgccccgtcccgccagccggactttatcgcctga

DBGET integrated database retrieval system