KEGG   Oceanimonas sp. GK1: GU3_06450Help
Entry
GU3_06450         CDS       T01667                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
oce  Oceanimonas sp. GK1
Brite
KEGG Orthology (KO) [BR:oce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GU3_06450
Enzymes [BR:oce01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GU3_06450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored DAO HI0933_like Glutaredoxin Thi4 AlaDh_PNT_C FAD_binding_3 NAD_binding_7 NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AEY01046
UniProt: H2FZ95
LinkDB All DBs
Position
complement(1391208..1392749)
Genome map
AA seq 513 aa AA seqDB search
MLDANLKKQLDTYLQNIVSPIAVSVSGDDSPKSNELLTLAEEISGLSDHISLAQASAART
PSMSIAAAGQAPRVTFAGIPMGHEFTSLVLALLQTGGHPSKAAPELLEQIRNLKGEFHFE
TYVSLSCQNCPDVVQALNLMATLNPNITHVMIDGALFQDEVNERQVMAVPAVYLNGEHFG
QGRMSLEEIVGKLDTGAAERQAEALNEQAPFDVLVVGGGPAGAAAAIYAARKGVRTGLVA
ERFGGQVMDTVGIENFISVPYTEGPKLAASLEQHVKEYEVELVTNQRAAGIRQNELIEVP
LESGAVLKSKSVILATGARWRELNVPGEAEYRNKGVAYCPHCDGPFFKGKKVAVVGGGNS
GIEAAIDLAGIVEHVTVVEFADSLRADEVLQRKARSMGNIDIIMNAQTTQVLGDGSRVNG
LQYTDRVSGETRRLDVAGIFVQIGLVPNTEFLKGSEVELTRFGEVMIDPRGATSMAGVFA
AGDATTVPYKQIIISMGAGATAALGAFDHLIRS
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatctcaaaaaacaattggacacctatctgcagaacatcgtctcgccg
atagcagtcagcgtgtccggtgacgactctcccaaatccaacgaattactgacgctggct
gaagagatcagcgggctgtcagaccacatcagcctggcgcaggcctccgccgcccgcacc
cccagcatgagcattgccgccgccggccaggcgccgcgggtaacctttgccggcattccg
atgggccacgaattcacctcgctggtgctggccctgctgcagaccggcggccatccctcc
aaggccgcgcccgaactgctggagcaaattcgcaacctcaagggcgagtttcatttcgaa
acctatgtgtccctgtcgtgccagaactgcccggacgtggtgcaggcactgaacctgatg
gccaccctgaaccccaacattactcatgtgatgattgacggtgccctgttccaagacgag
gtcaacgagcgccaggtcatggcggtgcccgccgtgtacctgaatggcgagcactttggt
cagggccgcatgagcctggaagagatcgtcggcaaacttgacaccggtgccgccgagcgc
caggccgaagccctgaacgaacaggcaccctttgacgtgctggtggtgggcggcggcccg
gcaggggccgcggcggccatttacgccgcccgcaagggggtgcgcaccggcctggtagcg
gagcgctttggcggccaggtgatggacacggtgggcattgaaaacttcatttccgtgccc
tacaccgaaggccccaaactggcggccagcctggagcagcacgtcaaggaatatgaggtg
gaactggttaccaaccagcgtgccgccggcattcggcagaatgagctgattgaagtgccg
ctcgaaagtggtgccgtgcttaaaagcaaatcggtgatccttgccaccggtgcccgctgg
cgcgagctgaatgtgcccggcgaagccgaataccgcaacaagggcgtggcctactgcccc
cattgcgacggtcccttcttcaagggcaagaaggtggcagtggtcggcggcggcaactcc
ggcattgaggcggccatcgatctggcgggcatcgtcgagcatgtcaccgtggtggaattc
gccgacagcctgcgcgccgacgaggtgctgcagcgcaaggcgcgctccatgggcaacatc
gacatcatcatgaatgcccagaccacccaagtgctgggcgacggcagccgggtgaacggc
ctgcagtacaccgatcgtgtcagcggtgaaaccaggcgcctggacgtggccggcatcttt
gtacagattggcctggtgcccaacaccgagttcctcaagggctcggaagtggagttgacc
cgctttggcgaagtgatgatagacccccgtggcgccacctccatggccggcgtgtttgcc
gccggggatgccactaccgtgccctacaagcagatcatcatttctatgggggccggcgcc
accgccgccctgggcgcctttgaccacctgatccggtcgtaa

DBGET integrated database retrieval system