KEGG   Oceanimonas sp. GK1: GU3_10950Help
Entry
GU3_10950         CDS       T01667                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
oce  Oceanimonas sp. GK1
Brite
Enzymes [BR:oce01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GU3_10950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEY01946
UniProt: H2FWG4
LinkDB All DBs
Position
2379355..2379939
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKNALEPHISQETLEYHHGKHHNTYVVNLNNLVPGTEFEGKSLEDIIKTS
SGGIFNNAAQVWNHTFYWHCLSPNGGGEPTGALADAIKAAFGSFDAFKEEFTKSAVTNFG
SGWTWLVKKADGTVGLVNTSNAGCPLTEAGLTPLLTCDVWEHAYYIDYRNVRPDYVKAFW
ALVNWDFVAENFAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaacttcccgcactgccttatgccaagaatgccctggaaccccatatctcc
caggaaaccctggaatatcaccacggcaaacaccacaacacctatgtggttaacctgaac
aacctggttcccggcaccgaattcgaaggcaagtccctggaagacatcatcaagacttct
tccggcggcatcttcaacaacgccgctcaggtctggaaccacaccttctactggcactgc
ctgtctcccaacggcggcggtgagcccaccggtgccctggccgatgccatcaaggcggcg
ttcggttctttcgacgccttcaaggaagagttcaccaagtctgccgtgaccaacttcggc
tccggctggacctggctggtgaaaaaggctgacggcaccgtgggcctggtaaacacctcc
aacgccggctgcccgctgaccgaagccggtctgactcccctgctgacctgcgatgtgtgg
gagcacgcttactacatcgactaccgcaacgtacgtcccgactatgtgaaagccttctgg
gccctggtcaactgggacttcgtagcagaaaacttcgccaagtaa

DBGET integrated database retrieval system