KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c11800Help
Entry
OCA5_c11800       CDS       T01617                                 

Gene name
fabI2
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH] 1
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
ocg00061  Fatty acid biosynthesis
ocg00780  Biotin metabolism
ocg01100  Metabolic pathways
ocg01130  Biosynthesis of antibiotics
ocg01212  Fatty acid metabolism
Module
ocg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ocg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    OCA5_c11800 (fabI2)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    OCA5_c11800 (fabI2)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    OCA5_c11800 (fabI2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ocg01004]
    OCA5_c11800 (fabI2)
Enzymes [BR:ocg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     OCA5_c11800 (fabI2)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     OCA5_c11800 (fabI2)
Lipid biosynthesis proteins [BR:ocg01004]
 Fatty acid synthase
  Component type
   OCA5_c11800 (fabI2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AEI05898
UniProt: B6JFJ2
LinkDB All DBs
Position
1257541..1258362
Genome map
AA seq 273 aa AA seqDB search
MAENTGLMRGKRGIILGVANNRSIAYGIAKSCRDQGAELALTWQGDALKKRVEPLAKELG
AITLGHCDVTDGASIDAVFEEAKKQWGKIDFVVHAIAFADKDELDGRYLDTTEANFSRSM
LISCYSLTAITQRAEKLMTEGGSILTLSYYGAEKWMPHYNVMGVAKAALEASVRYLAADL
GEKNIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLRRTVTQEEVGDSAMYLLSDLA
RGVTGEVHHVDSGYNVVGMKRPDAPDISLAGKD
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaataccggtctgatgcgcggtaagcgagggatcatccttggcgtcgcgaac
aaccgctcgattgcctatgggatcgccaaatcctgccgcgaccagggcgcggaactggcg
ctgacctggcagggcgatgcgttgaagaagcgcgtcgagccgctcgccaaggagctcggc
gcgatcacgctcggccattgcgacgtcaccgacggcgcttccatcgacgctgtgttcgag
gaagcgaaaaagcagtggggcaagatcgattttgtcgtccacgccattgcttttgccgac
aaggacgaactcgacggccgctatctcgacaccaccgaggcgaacttctcgcgctcgatg
ctgatctcctgctactcgctcacggcgatcacgcagcgcgccgagaagctgatgacggag
ggcggttcgattctcacgctgtcctattacggcgcggagaagtggatgccgcattacaac
gtcatgggcgttgccaaggcggcactcgaggcgagcgtgcggtatctcgcggccgatctc
ggcgagaagaacatccgcgtcaacgcgatttcggcgggaccgatcaagacgctcgccgcg
tccggcatcggcgatttccgctacatcctgaagtggaacgaatacaacgcgccgctgcgc
cgaaccgtgacgcaggaagaagtcggcgacagtgcgatgtatttgctgtccgatctcgcg
cgcggcgtcaccggcgaggtgcaccatgtcgattccggctataatgtcgtcggcatgaaa
cgccccgacgcgccggatatatcgcttgcggggaaagactga

DBGET integrated database retrieval system