KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c13880Help
Entry
OCA5_c13880       CDS       T01617                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase GlpD
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
ocg00564  Glycerophospholipid metabolism
ocg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ocg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    OCA5_c13880 (glpD)
Enzymes [BR:ocg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     OCA5_c13880 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C P_proprotein Pyr_redox_2 Pyr_redox FAD_oxidored 3HCDH_N NAD_binding_8 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AEI06104
UniProt: F8BX28
LinkDB All DBs
Position
1503028..1504539
Genome map
AA seq 503 aa AA seqDB search
MDHIYDLAIIGGGVNGCGIARDAAGRGYSVYLCEMNDLASGTSSWSSKLIHGGLRYLEFY
EFRLVREALIEREVLWGIAPHIIAPQRFVLPHHDGLRPAWLLRLGLFLYDHLGGRRRLPP
ARTLNLRRDIAGKPLKPGFKTGFSYSDCTVDDARLVVLNAQDAVARGATIATQTKAIRAE
RGDGVWQLEVEDATQARHTVKTRIVVNAGGPWVQDILTARVGVEATAHVRLVQGSHIVVP
RLYDNNYAYTFQHADGRVIFVIPYQRDFTLIGTTDRDYEGDPAAVRATQEEIDYLCAAAS
EYLATPVLPSDVVWSYSGVRPLYDDHASEARTATRDYMFELDAPEGLPVLSVFGGKITTY
RKLAEHALDKLSPYLRSAGKPWTADTPLPGGDFPMGEVDMLVQRLLREYPFLSQRHANRL
AHAYGTQAERVLGRAASFADLGRDFGHTLTEREVRYLMAHEFARTAEDVVWRRSKLGLWL
SREEIAALEAWMAAQSNLGAPAH
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
ttggatcatatctacgatctcgcgatcatcggtggtggcgtcaacggttgcggcattgcg
cgtgatgcggcggggcggggctattcggtctatttgtgcgagatgaacgatctcgcgagc
ggcacctcgtcatggtcgagcaagctcattcacggcggcttgcgttacctcgaattctat
gaattccgtctggtgcgcgaggcgctgatcgagcgcgaggtgctgtggggcatcgcgcct
cacatcatcgcgccgcaacgcttcgtgctgccgcatcatgatggcttgcggccggcatgg
cttctgcggctcgggctttttctctacgatcatctcggcggtcgccgccgtctgcctcct
gcacgcacgctgaatctgcgccgcgatattgcaggtaagccgctgaagccgggctttaaa
acgggcttttcctattccgattgcacggtggacgatgcgcgactcgtcgtgcttaacgcg
caggatgcagttgcacgcggcgcgaccatcgcgacacaaaccaaggcaatccgcgcagag
cggggcgacggcgtatggcagcttgaggtcgaagacgccacacaagcgcgtcacaccgtc
aagacccgcattgtggtgaatgccggcggcccctgggtgcaggatattctcaccgcgcgt
gtcggcgtcgaagcgacagcccacgtccgcctcgtgcagggctcgcacatcgtggtgccg
cggctttacgataacaactatgcctatacgttccagcacgccgacgggcgagtgatcttc
gtcattccctaccagcgcgatttcacgctgatcggcacgacggatcgcgattatgaggga
gaccccgcggcagtccgcgcgacgcaagaggagattgattatctctgtgccgctgcaagc
gaatatctcgcaacgcccgtcttgccgtccgatgtggtgtggagctattccggcgtgcgg
ccgctttacgatgaccatgcaagcgaggcacgcaccgccacgcgcgactatatgttcgag
cttgatgcgccggaggggctgcccgttctctcggtgttcggcggcaagatcacgacctat
cgcaagcttgccgaacatgcgctggacaagctgtcgccttacctccgcagtgcaggcaag
ccgtggacggcggatacgccgctaccgggtggcgattttccgatgggcgaagtcgatatg
ctcgtgcagcgcctcttgcgggaatacccgttcctgtcgcaacgccacgccaatcgactc
gcacatgcttatggcacgcaggccgagcgtgttctcggtcgggcagcaagtttcgccgat
ctcggccgagatttcggtcataccctgaccgagcgcgaggtgcgctatctgatggcgcat
gagtttgcgagaacggcggaagatgtcgtatggcgacgttccaagcttggcctgtggctg
tcgcgcgaagaaattgcagcgcttgaggcttggatggcggcgcaatcaaaccttggtgcg
cccgcgcattga

DBGET integrated database retrieval system