KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c17240Help
Entry
OCA5_c17240       CDS       T01617                                 

Definition
(GenBank) hypothetical protein
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2155
Motif
Other DBs
NCBI-ProteinID: AEI06438
UniProt: B6JG35
LinkDB All DBs
Position
1871383..1872276
Genome map
AA seq 297 aa AA seqDB search
MLRTAATISFATLIAASLFALPPARAQIGNIFSDQPLRPPAGLSHGDPTQDPDEEEVPEI
PQGRLLPAPQAARPLPPGQGAPRPGAVQSQPLAPPPGSATAPQQQPPNVAVNPPPGNALP
GQKPPAGNPQQSPATLQPGDEIVTEPPAIKIPNKKAVFSGLDKITGRIITFDQDIGETVQ
FGALRVKTDACYTRPATEAANTDAFVEVDEITLQNEVKRIFSGWMFAASPGLHAVEHPIY
DVWLIDCKSPEQPVTAQNEPVKPAPPPQQTQQRRQARPQPAQQPRQPAPPPPFGGYR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaaccgccgccacgatttcgtttgcgacactgatcgcggcctcgctgtttgcc
ttgccgccggcacgcgcgcagatcggcaacatcttttccgatcagccgctgcgtccgcct
gcgggcctgtcgcatggcgatcccacgcaagatcccgacgaagaggaagtcccggaaatt
ccgcagggtcgcctattgcctgcgccgcaggctgcgcgtccgctgccgccggggcagggt
gcgccacgccccggagcggtgcagtcccaaccgctggcgccgccgcctggcagtgcgaca
gcaccgcagcagcagcctcccaacgttgcggtcaatccgccgcccggcaacgcgctgccg
ggacagaagccgccggccggcaatccgcagcagtctccggcgacgctgcagcccggcgat
gaaatcgtcaccgagccacccgcgatcaagatcccgaacaagaaggcggtgttctccggc
ctcgacaagatcaccggccgcatcatcaccttcgatcaggatatcggcgagaccgtgcag
ttcggtgcgctgcgggtgaagacggatgcgtgctacacgcgccccgcgacggaagccgcc
aacaccgacgcctttgtcgaggtcgacgagatcacgctgcagaatgaagtgaagcggatt
ttctccggctggatgtttgcggcaagcccgggcctccacgcggtggagcatccgatctat
gacgtgtggctgatcgactgcaaatcacctgagcagcccgttaccgcgcagaacgagccg
gtgaagcccgcaccgccgccgcagcaaacacagcagcggcgtcaggcacggccgcagccg
gcccagcagccgcgccagcccgcgccgccgccacctttcggcggctatcgctga

DBGET integrated database retrieval system