KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_pHCG300470Help
Entry
OCA5_pHCG300470   CDS       T01617                                 

Gene name
cbbL
Definition
(GenBank) ribulose bisphosphate carboxylase large chain CbbL
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
ocg00630  Glyoxylate and dicarboxylate metabolism
ocg00710  Carbon fixation in photosynthetic organisms
ocg01100  Metabolic pathways
ocg01120  Microbial metabolism in diverse environments
ocg01200  Carbon metabolism
Module
ocg_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ocg_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OCA5_pHCG300470 (cbbL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OCA5_pHCG300470 (cbbL)
Enzymes [BR:ocg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     OCA5_pHCG300470 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N OMPdecase
Motif
Other DBs
NCBI-ProteinID: AEI08121
UniProt: Q6LBA6
LinkDB All DBs
Position
pHCG3:49050..50510
Genome map
AA seq 486 aa AA seqDB search
MNDQSMTIRGKDRYKSGVMAYKKMGYWEPDYVPKDTDVIALFRVTPQDGVDPIEAAAAVA
GESSTATWTVVWTDRLTAAEKYRAKCYRVDPVPNSPGQYFAYIAYDLDLFEPGSISNLTA
SIIGNVFGFKPLKGLRLEDMRLPVAYVKTFQGPATGIVVERERLDKFGRPLLGATVKPKL
GLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRERFLYCMEAVNRAQAASGEVKGT
YLNVTAATMEDMYERAEFAKELGSCIVMIDLVIGYTAIQSMAKWARKNDMILHLHRAGHS
TYTRQKNHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPNTTRGYYDICREEFNPTKLE
HGIFFDQNWASLNKMMPVASGGIHAGQMHQLLDLLGEDVVLQFGGGTIGHPMGIQAGAIA
NRVALEAMILARNEGRDYVAEGPEILAKAAATCTPLKSALEVWKDVTFNYESTDAPDFVP
TAIAAV
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatcaatcgatgaccatccgcggcaaggaccgctacaagtccggcgtcatggcc
tacaagaaaatgggctattgggagcctgactacgttcccaaggacaccgacgtgatcgcg
ctgttccgcgtgactccgcaggacggtgttgatccgatcgaggcggctgccgcggtggcg
ggcgaatcctcgaccgcgacttggaccgtggtctggaccgaccgtctgacggcggcggag
aaatatcgcgcgaagtgttatcgcgtcgatccggtgccgaattcgccgggccagtacttt
gcctacatcgcctacgatctcgatctgttcgagcccggctcgatctcaaatctgaccgcg
tcgatcatcggcaacgtgttcggtttcaagccgctgaagggcttgcgtcttgaggatatg
cgtttgccggtcgcctacgtgaagaccttccagggtccagcgaccggcatcgtagtcgag
cgcgagcgtctcgacaaattcggccggccgttgcttggcgccacggtgaagccgaagctt
ggtctctcgggccgcaattacggccgcgtggtctatgaggcgctcaagggcggtctcgac
ttcaccaaggacgacgagaacatcaactcgcagcccttcatgcactggcgtgagcgtttc
ctctattgcatggaagcggtgaaccgcgcgcaagcggcatccggcgaagtgaagggaacg
tatctcaacgtcaccgcggcgacgatggaggacatgtacgagcgtgccgagttcgccaag
gaactcggatcctgtatcgtcatgatcgatcttgtgatcggctataccgccattcagtcg
atggcgaagtgggcgcgcaagaacgacatgatcctgcatctgcatcgcgcgggtcactcg
acatacacccgccagaagaaccatggcgtgtcgttccgcgtcattgccaagtggatgcgt
cttgccggtgtcgatcacatccatgccggcaccgtggtcggcaagctcgaaggcgatccg
aacaccacgcgcggctactacgatatctgccgcgaggagttcaacccgacgaagctcgaa
catggcatcttcttcgaccagaactgggccagcctcaacaagatgatgccggtggcatcc
ggcggcatccatgccggtcagatgcatcagcttctcgacttgctcggcgaggatgtggtg
ttgcagttcggcggcgggaccatcggccatccgatgggcatccaggccggtgcgatcgcc
aaccgcgtcgcgctcgaggccatgatcctggcccgcaacgaaggacgtgactacgttgcc
gaaggtccggaaattctggccaaggcggctgcgacctgtacgccgctgaagtcggcgctc
gaggtctggaaggacgtgaccttcaactacgaatccaccgatgcgccggacttcgttccg
accgcgatcgccgctgtttaa

DBGET integrated database retrieval system