KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_pHCG300480Help
Entry
OCA5_pHCG300480   CDS       T01617                                 

Gene name
cbbS
Definition
(GenBank) ribulose bisphosphate carboxylase small chain CbbS
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
ocg00630  Glyoxylate and dicarboxylate metabolism
ocg00710  Carbon fixation in photosynthetic organisms
ocg01100  Metabolic pathways
ocg01120  Microbial metabolism in diverse environments
ocg01200  Carbon metabolism
Module
ocg_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ocg_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:ocg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OCA5_pHCG300480 (cbbS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OCA5_pHCG300480 (cbbS)
Enzymes [BR:ocg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     OCA5_pHCG300480 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AEI08122
UniProt: F8C112
LinkDB All DBs
Position
pHCG3:50527..50952
Genome map
AA seq 141 aa AA seqDB search
MRITQGCFSFLPDLTDEQIKKQIQYCLGKDWAVNIEFTDDPHPRNTYWEMWGLPMFDLRD
AAGIMMELKECRKVYGDRYIRINAFDSSHGWESVRISFIVNRPKNEPGFRLARQEVGGRN
MRYTTTSYAADRPEGQRYNGA
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattacacaaggttgcttttccttcctccccgatctgaccgacgaacagatcaag
aagcagatccagtattgcctcggcaaggattgggccgtgaacatcgaattcacggacgat
ccgcacccgcgcaacacgtattgggagatgtggggcctgccgatgttcgatctgcgcgat
gccgcaggcatcatgatggagctgaaggagtgccggaaggtctatggagaccgctacatc
cggatcaatgccttcgactccagccatggttgggaatcggtgcgcatttcgttcatcgtg
aaccgcccgaagaacgagcccggcttccgtctggcacgtcaggaggtcggtggccgtaac
atgcgttacaccacgacgtcctatgcggccgatcgccctgaaggtcagcgctacaacgga
gcatga

DBGET integrated database retrieval system