KEGG   Ochrobactrum sp. A44: CES85_0222Help
Entry
CES85_0222        CDS       T05040                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
och  Ochrobactrum sp. A44
Pathway
och00564  Glycerophospholipid metabolism
och01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:och00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CES85_0222
Enzymes [BR:och01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CES85_0222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox_2 Mqo NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ASV86309
UniProt: A0A248UJ62
LinkDB All DBs
Position
1:221881..223404
Genome map
AA seq 507 aa AA seqDB search
MAQNKIFDKIFDIFVIGGGINGCGIARDAVGRGFSVGLAEMNDLASGTSSRATKLIHGGL
RYLEHYEFRLVREALMEREVLWANAPHLIHPMRFVLPFHKGGVRPAWLLRLGLFLYDHLG
GRKKLPATRTLDMRTDPSSAPLKPLFTKAFEYSDCWVDDARFTALTARDAADRGAMIRTR
TKVVSARRDHEAWTVTLENIDTGGREEVRARLLVNAAGPWADKVLQGVEGDRQLHNVRLV
QGSHIVVRKKFSDPRSYFFQNNDGRIIFAIPYEDDFTLIGTTDQDYKGDPAKVAISDRET
DYLCACASEYFKEPVRLEDIVWTYSGVRPLYDDGASKAQEATRDYVLKEDAPQDAAPLIN
VFGGKLTTARRLAEHMLEKIEHRLGKKGASWTHAAPLPGGDFEATSFDRELEKLKAAYPF
LSSTHARRLFRLYGTRAHVLLGKASSLADLGRHFGADLYEAEVRYLVENEWAHTAQDILW
RRTKLGLRMNAIEVSALEAFVQPVKAA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagaataaaatattcgataaaatattcgacattttcgtaatcggtggcggcatc
aacggatgcggcattgcaagagacgccgtggggcgtggcttctctgttggtcttgccgag
atgaacgatctggcaagtggcacctcgtcgcgcgccaccaagctcattcatggtggtttg
cgctatctggagcattacgagttccgtctggtgcgcgaagcgctgatggagcgcgaagtg
ctgtgggccaatgcgccgcatctcattcatccgatgcgctttgtgctgccttttcacaag
ggcggcgtgcgtccggcctggcttttgcgccttggcctgtttctgtacgatcatctgggt
ggtcgcaagaaactgcctgcgacgcgcacactcgacatgcgaaccgacccttctagcgca
ccattgaagccacttttcaccaaggctttcgaatattcggattgctgggtggatgatgct
cgtttcaccgccctgactgcgcgtgacgccgccgatcgtggagcgatgatccgcacacgg
accaaggtcgtatccgcgcgccgtgaccatgaagcatggactgtgacgctggaaaatatc
gacactggcgggcgcgaagaggttcgtgcgcgtctgctggtcaatgccgctggcccatgg
gccgataaagtattgcagggcgttgagggcgatcgacaactgcacaatgtgcgtctggtt
cagggtagccatatcgtggtgcgcaaaaagttctccgatccgcgttcctatttcttccag
aacaatgacggacgtatcatctttgccattccctacgaggacgattttacgctgatcggc
accactgatcaggactataagggcgacccggccaaagttgcgatcagtgacagggaaacc
gattatctctgcgcttgtgccagtgaatatttcaaggagccagtgcgccttgaggatatt
gtctggacctattccggtgtgcgcccgctttatgatgacggcgcaagcaaggcgcaggaa
gcaacccgcgattatgtgttgaaagaagatgcccctcaggatgccgctccgctgatcaac
gtgttcggtggcaagctgaccacggctcgcaggctagccgagcatatgcttgagaagatc
gagcatcgtttaggcaaaaaaggtgcatcatggacccatgcagcacctctgccgggtggc
gattttgaggcaacgtcctttgatcgtgagcttgaaaagctgaaagcggcctatccgttt
ctttcgtccactcatgcgcgtcgtttgttcaggctctatggaacgcgagcacacgtactg
cttggcaaggcgagttcgctggctgatctcgggcggcattttggtgccgatctctacgaa
gcagaagtgcgctatctcgttgagaatgagtgggcgcatacagcacaagacattttatgg
cggcgcacaaaacttggcctgcgaatgaacgcgatagaggtttctgctcttgaggctttc
gttcaaccagtgaaagctgcttaa

DBGET integrated database retrieval system