KEGG   Ochrobactrum sp. A44: CES85_0225Help
Entry
CES85_0225        CDS       T05040                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
och  Ochrobactrum sp. A44
Pathway
och00010  Glycolysis / Gluconeogenesis
och00620  Pyruvate metabolism
och01100  Metabolic pathways
och01110  Biosynthesis of secondary metabolites
och01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:och00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CES85_0225
   00620 Pyruvate metabolism
    CES85_0225
Enzymes [BR:och01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     CES85_0225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ASV85318
UniProt: A0A248UF57
LinkDB All DBs
Position
1:224595..226112
Genome map
AA seq 505 aa AA seqDB search
MNKVEFHRSVKPEFAKRYGNFIGGKWVEPKSGRYFENTSPVNGQVLCEVARSDAADVDAA
LDAAHAAKDAWGRTSPAERAVILNKIADRIEANLPKLAAAETWDNGKPIRETTNADLPLA
IDHFRYFAGAIRAQEGGISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALAA
GNCVVLKPAEQTPASILVLMEIIGDLLPAGVLNVVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFSDVTAEDDDFFDKAIEGFVMFALNQGEVC
TCPSRALIHEKIYDKFMERALKRVEAIVQGDPLDPATMIGAQASSEQLEKILSYIDIGKQ
EGAEVLTGGGRNELAGDLAGGYYVKPTVFKGTNKMRIFQEEIFGPVVSVTTFKDDAEALA
IANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRENH
LKMLDHYQQTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggtagaatttcatcgctccgtaaagccggagtttgccaaacgctatggcaat
ttcattggcggcaaatgggttgaacccaagtctggccgctatttcgaaaacacatcccca
gtcaatggccaggttctgtgcgaagttgcacgttctgatgcggccgatgttgatgcggct
cttgatgcggcacacgcagccaaggatgcatggggcagaaccagccctgctgaacgtgcc
gttatccttaacaagatcgcagaccgcatcgaggcaaatctgccgaaactcgcagccgct
gaaacatgggacaacggcaagccgatccgcgaaaccacaaatgcggatctgccacttgct
attgatcacttccgttattttgccggtgcaatccgtgcgcaggaaggcggaatttcggaa
atcgaccacgacacggtcgcttaccatttccacgagccgctcggtgtcgtcggccagatt
attccgtggaacttcccaattcttatggctgtttggaagctggcgccagcacttgctgcc
ggtaactgcgtggtgctgaagccagcagaacagacacctgcatccatcctcgtgctgatg
gagatcattggtgatcttctgcctgcgggcgtgctcaacgtagtcaatggtttcggtctg
gaagctggcaagccacttgcatcgagcccgcgcatagccaagatcgcctttaccggtgaa
acgacgaccggtcgtctcatcatgcaatatgccagccagaaccttatcccggttacgctg
gaactgggcggcaagtcgccaaacatcttcttctccgacgtcactgcggaagatgacgat
ttcttcgacaaggctatcgaaggctttgtcatgttcgcgcttaatcagggcgaagtctgc
acctgtccaagccgtgcgctgattcatgaaaaaatctatgacaagttcatggaacgcgct
ttgaagcgtgtcgaggcaatcgttcagggtgatcctcttgatccggcaaccatgatcggt
gcgcaggcatctagcgaacagctggaaaaaatcctgagctatatcgatatcggcaagcag
gaaggtgcagaagtgttgaccggcggtggacgcaatgagctcgccggtgatctggcaggc
ggctattacgtcaagccgaccgtcttcaaaggcaccaacaagatgcggattttccaggag
gaaatcttcggtcctgttgtttcggtcacgacctttaaggacgatgccgaagcgctcgcg
attgccaatgacacactttatggtcttggcgcaggtgtatggacgcgtgacggtacgcgc
gcttatcgctttggtcgtgccattcaggcaggccgcgtctggacgaattgctaccacgcc
tatccggcccatgcggcgttcggtggctataagcagtcgggtatcggtcgtgaaaaccac
ctcaagatgctcgaccattaccagcagaccaaaaacatgctggtgagctacagcccgaag
aagctcggcttcttctaa

DBGET integrated database retrieval system