KEGG   Ochrobactrum sp. A44: CES85_0971Help
Entry
CES85_0971        CDS       T05040                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
och  Ochrobactrum sp. A44
Pathway
och00970  Aminoacyl-tRNA biosynthesis
och01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:och00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CES85_0971 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:och03029]
    CES85_0971 (gatB)
Enzymes [BR:och01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CES85_0971 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CES85_0971 (gatB)
Mitochondrial biogenesis [BR:och03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CES85_0971 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ASV86961
UniProt: A0A248UKN6
LinkDB All DBs
Position
1:922108..923610
Genome map
AA seq 500 aa AA seqDB search
MTLIDTRTPEPKRFISGATGDWEIVIGMEVHAQVTSESKLFSGASTSFGAAPNANVSLVD
AAMPGMLPVINVECVKQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG
EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSIHDQHPTMSYVDLNRSGVALMEIVS
KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV
NSIRFVGQAIEYEARRQIGILEDGGSIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD
LLPLEFDQAFVDALAAELPELPDVKKDRLVEKLGISIYDASILVTEKAIADYYEAVAEGR
DGKAAANWVINDLLGALNKAGKDIEESPVSPDQLGAIIDLIKDGTISGKIAKDLFEIVWN
EGGDPKSLVEERGMKQVTDTGAIEKAVDDIIAANPDKVEQAKAKPTMAGWFVGQVMKATG
GKANPQAVNDLVKSKLGIEE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacccttattgatacgcgtacgcccgaaccaaaacgcttcatctctggcgccaccggc
gactgggaaatcgtcattggcatggaagtccacgctcaggtcacgtccgagtcgaaactg
ttctcaggcgcttctacatcgtttggcgcagctccgaatgccaatgtgtctctggttgat
gcggcgatgccgggcatgttgcctgtcattaatgtggaatgcgtcaagcaggccgtgcgt
acgggtatcggcctcaatgcgcagatcaatctgaagtcggtattcgaccgcaagaactac
ttctatcccgatctgccgcagggttatcagatttcgcagttcaagcagccgattgttggc
gaaggcaagatcatgatctcggtcggccccgacaataaggggcagttcgaagatgtcgag
atcggcattgaacggctccatctcgaacaggatgccggcaagtcgattcacgatcagcat
ccgacgatgtcttatgttgatttgaaccgctctggcgtggcgctgatggaaatcgtctcc
aaacctgacctgcgttcgtctgatgaggcccgtgcctatttgaccaagctgcgcacgatt
gtccgttatctcggcacttgcgatggcaatatggacgaaggctcaatgcgtgccgacgtg
aacgtttctgtgcgtcgtccaggtggtgagttcggcacacgttgcgaaatcaagaacgtc
aattccatccgctttgtcgggcaggccattgaatatgaagcacgtcgccagatcggtatt
ttggaagatggcggctctatcgatcaggaaacccgcctgtttgatcctgtaaaaggcgaa
acgcgttcgatgcgctcgaaggaagaagcgcacgattatcgctatttcccggatccagac
cttttgccgcttgaattcgatcaggcatttgttgatgcgcttgccgctgaattgccggaa
ctgccagacgtcaagaaagaccgcctcgtcgaaaaactcggcatttcgatctatgacgca
tcgattctggtcactgaaaaagccatcgctgactattatgaagcggttgctgaaggccgc
gacggtaaggccgctgcgaactgggtcatcaatgatcttcttggcgcgctgaacaaggct
ggcaaggacattgaagaatcgccagtttcgccagatcagcttggtgcgattatcgatctc
atcaaggacggcacgatttccggcaagatcgccaaggatctgttcgagatcgtctggaac
gaaggtggtgatccgaagagcctcgttgaagaacgcggcatgaagcaggttactgacacc
ggcgctatcgaaaaggcagttgacgatatcatcgcagctaacccggacaaggttgagcag
gccaaggcaaagccaaccatggctggttggttcgttggtcaggtgatgaaggcaacaggt
ggcaaggctaacccgcaggccgtcaacgatctggtcaagtccaagcttgggattgaagaa
taa

DBGET integrated database retrieval system