KEGG   Ochrobactrum sp. A44: CES85_1378Help
Entry
CES85_1378        CDS       T05040                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
och  Ochrobactrum sp. A44
Brite
KEGG Orthology (KO) [BR:och00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:och03012]
    CES85_1378
   03029 Mitochondrial biogenesis [BR:och03029]
    CES85_1378
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:och04147]
    CES85_1378
Translation factors [BR:och03012]
 Eukaryotic Type
  Elongation factors
   CES85_1378
 Prokaryotic Type
   CES85_1378
Mitochondrial biogenesis [BR:och03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CES85_1378
Exosome [BR:och04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CES85_1378
  Exosomal proteins of breast cancer cells
   CES85_1378
  Exosomal proteins of colorectal cancer cells
   CES85_1378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ASV85867
UniProt: A0A248UGC3
LinkDB All DBs
Position
1:complement(1300788..1301963)
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKFFGEFKAYDQIDAAPEERARGITIST
AHVEYETAARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKCDQVDDAELLELVELEVRELLSKYDFPGDEVPIIKGSALAALEDSSKE
LGEDAIRNLMAAVDDYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIKATGKTTVTGVEMFRKLLDQGQAGDNIGALVRGVGRDDVERGQVLCKPGSVKPHT
KFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGVVTLPEGTEMVMPGDNVTVDVTL
IVPIAMEEKLRFAIREGGRTVGAGIVASIIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaagtttgaacgtaataagccccacgtaaacatcggcacgattggtcac
gttgaccatggcaagacgtcgttgacagcagcaatcacgaagttcttcggtgaattcaag
gcatacgaccagatcgatgctgcaccagaagaacgcgctcgcggtatcaccatttcgacg
gcacacgttgaatatgaaactgcagctcgtcactatgcacacgtcgactgcccaggccac
gctgactatgtcaagaacatgatcaccggtgctgcacagatggacggcgcgatcctggtt
gtttcggcagctgacggcccgatgccacagacccgtgagcacatcctgctcgctcgtcag
gttggtgttcctgcgatcgtcgtgttcctgaacaagtgcgatcaggttgacgatgctgaa
cttctcgagctcgtagaactcgaagttcgtgaactgctttcgaagtacgacttcccaggc
gacgaagttccaatcatcaagggctcggctcttgctgctctggaagattcttcgaaggaa
ctcggcgaagacgcaatccgcaacctgatggctgcagttgacgactacattccgacgcca
gagcgtccgattgaccagccgttcctgatgccaatcgaagatgttttctcgatttcgggt
cgtggtactgttgttaccggtcgtgttgagcgcggtatcgttaaggttggcgaagaagtc
gaaatcgttggcatcaaggccaccggcaagacgactgttaccggcgttgaaatgttccgc
aagctgctcgatcagggccaggctggcgacaacatcggtgcactggttcgcggtgtaggc
cgtgacgacgttgaacgtggtcaggttctctgcaagccaggttcggttaagccgcacacc
aagttcaaggcagaagcctacattctgaccaaggacgaaggtggccgtcatacgccattc
ttcaccaactaccgtccacagttctacttccgtacgactgacgtgaccggtgttgttacc
ctgccagaaggcacggaaatggttatgcctggcgacaacgttaccgttgacgttacgctg
atcgtcccgatcgcaatggaagagaagctccgcttcgctatccgtgaaggtggccgtacc
gtcggtgcaggcatcgtcgcttcgatcatcgagtaa

DBGET integrated database retrieval system