KEGG   Ochrobactrum sp. A44: CES85_1566Help
Entry
CES85_1566        CDS       T05040                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
och  Ochrobactrum sp. A44
Pathway
och00473  D-Alanine metabolism
och00550  Peptidoglycan biosynthesis
och01100  Metabolic pathways
och01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:och00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CES85_1566
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CES85_1566
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CES85_1566
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:och01011]
    CES85_1566
Enzymes [BR:och01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CES85_1566
Peptidoglycan biosynthesis and degradation proteins [BR:och01011]
 Precursor biosynthesis
  Amino acid ligase
   CES85_1566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: ASV87240
UniProt: A0A248UL27
LinkDB All DBs
Position
1:complement(1491851..1492750)
Genome map
AA seq 299 aa AA seqDB search
MGGFSSERPVSLSSGAACATTLEECGYRVTRIDVDRNVASVLAELRPDVAFNALHGPFGE
DGAIQGILEYLQIPYTHSGVLASALAMDKDRAKKVAAAAGVAIAPSRLMNRFDIGSEHPM
EPPYVVKPVREGSSFGVVIVKEDQSHPPQIIGSTDWRYGDEVMVEGYIAGRELTCAVMGD
RAMDVCEIIPVGHQFYDYDSKYVAGASTHACPAKILPNIYQKIQTMALTAHRAIGCRGVS
RSDFRFDDRFSEEGEVIWLEINTQPGMTPTSLVPDIAKAAGISFGELLSWMVEDASCLR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtttctcttctgagcgtcctgtcagcctatcctccggtgctgcctgtgcgaca
acgcttgaagagtgcggctaccgcgtcacgcgtatcgatgtcgaccgcaatgttgccagc
gttcttgcagagctgaggcctgatgtggcgttcaatgcgttgcatggcccttttggtgag
gatggcgctattcagggtatccttgaatatcttcagatcccttacacgcattccggcgtg
ctcgcttcggcgcttgccatggacaaagatcgcgccaagaaggttgctgctgctgccggt
gtggctattgcgccatcacgtttgatgaaccgttttgatattggttcagagcatccgatg
gagccgccatacgtcgtcaaacctgtgcgtgaaggctcaagcttcggtgtcgttatcgtc
aaggaagaccagtcgcatccgcctcagattattggttctactgactggcgctatggcgat
gaggtcatggtcgagggttatattgccggtcgtgaattgacctgcgctgtgatgggtgat
cgcgcgatggatgtctgcgagatcattccagtgggtcatcagttctacgattatgattca
aaatatgtggctggcgcatcaactcacgcatgtccggcaaaaattttaccaaatatttac
caaaaaatacaaacaatggcccttacggcgcatcgggcaatcgggtgtcggggcgtaagc
agatcagacttccgtttcgatgatcgtttttccgaagaaggcgaagttatttggctggaa
attaacacccagccaggaatgactcctacatcgctcgtgcctgatatcgcgaaggcggca
ggtatctcttttggtgaattgttgagttggatggtggaggacgcgtcttgtttgcggtaa

DBGET integrated database retrieval system