KEGG   Ochrobactrum sp. A44: CES85_1866Help
Entry
CES85_1866        CDS       T05040                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
och  Ochrobactrum sp. A44
Pathway
och00473  D-Alanine metabolism
och01100  Metabolic pathways
och01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:och00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CES85_1866 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CES85_1866 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:och01011]
    CES85_1866 (alr)
Enzymes [BR:och01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CES85_1866 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:och01011]
 Precursor biosynthesis
  Racemase
   CES85_1866 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Yop-YscD_ppl
Motif
Other DBs
NCBI-ProteinID: ASV85065
UniProt: A0A248UEB2
LinkDB All DBs
Position
1:1766079..1767218
Genome map
AA seq 379 aa AA seqDB search
MSMHFSQTERDLAAGGVLTIDLAALRHNYSTIAKRIAPTRAAAVVKADAYGLGADRVAPA
FYDAGCRDFFVAHLGEAITLRPFLNPDATLYVLNGLQPGTEAACARENILPVLNSLEQIE
NWSALAASLNEKLPALLQIDTGMSRLGLSAKELDQLVDDQHLLDHIDVKFVISHLASGDE
PENPANARQLAAMNTALARLPKLPVAFSNSGGCFLDNTYHYNLARPGVALYGVGPERGEN
PMKPVLELSARVIQVRDIDKGAAVGYGGTFVASKPTRIATIAVGYADGWFRALSNKGSAF
YGDTRLPIVGRVSMDSITLDVTALPEDTLKLGSLVELVGPHQRLEDVARDCDTIPYEILT
SLGHRYTRVYVDSETGTHA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgcatttttctcaaacggaacgagacctcgccgcaggcggtgttctcaccatc
gacttggcagccctgcgtcacaattactcgacgattgcaaagcgcatcgcgccaacccgc
gcagctgctgttgtcaaagctgacgcttatggcttgggcgccgaccgcgtagcgccagct
ttctatgacgcaggctgccgcgatttcttcgtcgcccatcttggcgaagcaattacgctg
cgcccttttctcaatcctgatgcgacgctttatgtgttgaatggccttcagcccggcacg
gaagctgcctgcgcacgtgagaacatcctgcctgttctcaactcactggagcagattgaa
aactggtcggcacttgccgcaagcctgaacgaaaaactgcccgctctgctgcaaatcgat
accggcatgtcgcgccttggtctgtcagccaaagaacttgatcaactggtcgatgaccag
catctgcttgaccatatcgatgtaaaattcgtcatcagccatcttgcaagcggcgatgaa
ccggaaaacccggcaaatgcccgccagcttgcggccatgaatacagctctcgcacgtttg
ccaaaactgcctgtggccttttcaaattccggcggctgtttccttgacaacacctatcac
tacaatctcgcccgtcccggcgtagccctctatggcgtcggtcctgaaaggggcgagaat
cctatgaagccggtccttgagctatcagcgcgtgttatccaggtgcgtgacatcgataag
ggtgcggcagtcggttacggcggcacattcgtagcaagcaagcctacgcggattgcaacc
attgcggtcggttatgccgatggttggttccgcgctttgagcaataaaggctcggctttc
tatggcgacacgcgcctgccgattgttggtcgtgtttcgatggattcgatcacgctcgat
gtaacagcacttccagaagacacgctcaagctcggcagtctggtcgaactcgtcggacca
catcagcggctcgaagatgtagcgcgggattgtgacaccattccttatgaaatcctgact
tcgttaggccaccgctatacccgcgtttacgtcgatagcgaaactggcacacacgcataa

DBGET integrated database retrieval system