KEGG   Ochrobactrum sp. A44: CES85_2511Help
Entry
CES85_2511        CDS       T05040                                 

Gene name
sucA
Definition
(GenBank) oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
och  Ochrobactrum sp. A44
Pathway
och00020  Citrate cycle (TCA cycle)
och00310  Lysine degradation
och00380  Tryptophan metabolism
och01100  Metabolic pathways
och01110  Biosynthesis of secondary metabolites
och01120  Microbial metabolism in diverse environments
och01130  Biosynthesis of antibiotics
och01200  Carbon metabolism
Module
och_M00009  Citrate cycle (TCA cycle, Krebs cycle)
och_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:och00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CES85_2511 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    CES85_2511 (sucA)
   00380 Tryptophan metabolism
    CES85_2511 (sucA)
Enzymes [BR:och01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CES85_2511 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ASV85909
UniProt: A0A248UHZ0
LinkDB All DBs
Position
1:complement(2358946..2361951)
Genome map
AA seq 1001 aa AA seqDB search
MARQEQANDVFALTSFLYGGNADYIEELYAKYEDDPNSVDAEWRDFFAQLKDDADDVRKN
AQGASWTKPNWPIPANGELVSALDGNWADVEKHVTDKLKGKAGKGDAKSAAAAALTAEEI
AQAARDSVRAIMMIRAYRMRGHLHANLDPLGLAEKPNDFSELDPSSYGFTPADYTRKIFI
DNVLGLEYATVPQMLEILKRTYCGNIGVEFMHISDPVEKAWIQERIEGPDKGYAFTAEGK
KAILSKLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQIVKRGGQMGLKEVVLGMAH
RGRLNVLSQVMGKPHRAIFHEFKGGSYAPDDVEGSGDVKYHLGASSDREFDGNKVHLSLT
ANPSHLEIVNPVVMGKARAKQDLLVGRTRDDMVPLSERAKVLPLLLHGDAAFAGQGVVAE
CLGLSGLKGHRVGGTLHFIINNQIGFTTNPAFSRSSPYPSDVAKMIEAPIFHVNGDDPEA
VVFAAKVAMEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQPLMYKEIRAHKTTVQLYSE
KLLGEGLVTQADIDKMKADWRERLEQEFEAGQSYKPNKADWLDGAWAGLRTADNADEQRR
GKTGVPIKTLKEIGKKLVEVPKDFNVHRTIQRFLDNRAKMIETGEGIDWATAESLAFGSL
VAEGSPIRLSGQDVERGTFSQRHTVLYDQETQNRYTPLNNIQKGQAIYEAINSMLSEEAV
LGYEYGYSLSDPRALVLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGFEG
QGPEHSSARLERWLQMCAEDNMQVANVTTPANYFHILRRQMKRDFRKPLIMMTPKSLLRH
KRAVSTLNELSGDSSFHRLLWDDAQYNKGDGIKLQKDAKIRRVVLCSGKVYYDLYEEREK
RGIDDVYLLRVEQLYPFPAKALINELSRFRHAEIVWCQEEPKNMGAWSFIDPYLEWVLAH
IDAKHQRVRYTGRPAAASPATGLMSKHLAQLEAFLEDALGN
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggcaagaacaagccaacgacgttttcgcccttacctcgttcctctatggcggc
aatgccgattatatcgaggagctttacgccaagtatgaggatgatcccaactcggtcgat
gctgagtggcgcgatttcttcgcgcagctgaaagacgacgccgatgatgtgcgcaagaat
gcgcagggtgcatcctggacaaagccgaactggcccattcctgcgaatggcgagctggta
tccgcgcttgatggcaactgggctgacgttgaaaagcacgttaccgacaagctgaagggt
aaagccggaaaaggcgatgccaaaagtgcggcagctgctgccctgacagccgaagagatt
gcacaggctgcacgcgacagcgttcgcgccatcatgatgatccgtgcctatcgcatgcgc
ggccatctgcatgccaatctcgatccgctcggtcttgctgaaaagccaaatgatttcagc
gaactcgatccatcgagctatgggtttacgcctgctgactacacacgcaagatcttcatc
gacaacgtactcggtctcgaatatgcgaccgttccgcagatgcttgaaatcctcaagcgc
acctattgcggcaatatcggcgtcgagttcatgcatatttccgatccagttgaaaaggct
tggattcaggaacgcatcgaaggtccagacaaaggctatgctttcactgctgaaggcaag
aaggccattctgtcgaagctgatcgaagccgaaggtttcgagcagttcattgacgtgaag
tataagggcaccaagcgttttggtcttgatggcggtgaatctctgattccggcactggaa
cagatcgtcaagcgtggcggccagatgggcctcaaggaagtcgtgctcggcatggcgcac
cgtggtcgtctgaacgtgctttcccaggttatgggcaagccgcatcgcgctatcttccac
gagttcaagggcggttcttacgcaccggacgatgtggaaggttcgggcgacgtgaagtat
caccttggtgcttcatcggaccgtgagttcgatggcaacaaggttcacctttcgctgacc
gcaaatccgtcgcatcttgaaatcgtcaacccggttgtcatgggtaaggcgcgcgccaag
caggacctgcttgttggccgcacccgcgatgacatggtgccattgagcgaacgcgcaaag
gttctgccgctgctgctgcacggtgatgctgcattcgctggtcagggcgttgtagctgag
tgccttggtctttcgggccttaagggtcaccgcgtcggcggtacgctgcacttcatcatc
aacaaccagatcggtttcaccaccaatccggccttctcgcgttcatcgccttatccatcg
gatgtggcaaagatgattgaagcgccgatcttccacgtcaatggtgacgatccggaagct
gtggtttttgcagccaaggttgcaatggaattccgcatgaccttccacaagccggtggtc
atcgacatgttctgctaccgtcgcttcggccacaatgaaggtgacgaaccttcattcacc
cagccgttgatgtacaaggaaatccgcgctcataagaccactgttcagctctacagcgaa
aagctgcttggcgaaggtcttgtaacgcaggctgacatcgacaagatgaaggcggactgg
cgtgagcggcttgaacaggaatttgaagctggtcagagttataagccaaacaaggctgac
tggctggacggtgcctgggctggcctgcgcacagcagacaatgcagacgaacagcgccgc
ggcaagaccggtgtaccgatcaagacgctcaaggaaatcggtaagaagcttgttgaagtg
ccgaaggatttcaacgtccatcgcaccatccagcgcttccttgataaccgcgccaagatg
atcgaaaccggtgaaggcatcgattgggcaaccgctgaatcgctggcgtttggttcgctg
gttgctgaaggcagcccgatccgcctgtcgggtcaggacgttgaacgcggcactttctcg
cagcgtcacacggttctctacgatcaggaaacccagaaccgctatacgcccctgaacaac
attcagaaggggcaggcgatctacgaagccatcaactcgatgctttcggaagaagcagtg
ctcggctacgaatatggttattcgctgtccgatccgcgtgctctggtcctctgggaagct
cagttcggcgatttcgccaacggtgcacaggtcgttttcgatcagttcatctcgtcgggt
gagcgcaagtggcttcgtatgtccggtcttgtctgccttctgccgcatggttttgaaggt
caaggtcctgagcattcctcggcacgtctggagcgctggttgcagatgtgtgcggaagat
aacatgcaggtcgccaacgttacgacgccggctaactacttccacattctgcgccgtcag
atgaagcgtgacttccgtaagccgctcatcatgatgacgccgaaatcgctgctgcgccac
aagcgtgctgtttcgaccctcaacgaactgtcgggcgattcttcgttccaccgtctgcta
tgggatgatgcccagtacaacaagggcgatgggatcaagcttcagaaggatgccaagatc
cgtcgcgtcgttctgtgctcgggcaaggtctattacgatctgtatgaagagcgcgaaaag
cgtggcatcgatgatgtctacctgctgcgtgtggaacagctttatccgttcccggctaag
gcgctcatcaatgagctctcgcgcttccgtcatgcggaaatcgtctggtgtcaggaagaa
ccaaagaacatgggtgcgtggtcgttcatcgatccgtatctggaatgggttcttgcacat
atcgacgccaagcatcagcgcgttcgctacaccggtcgtccggcagcagcttcgcctgcg
acgggtctgatgtcgaagcatcttgcacagctcgaggctttcctcgaggatgcgcttgga
aactaa

DBGET integrated database retrieval system