KEGG   Ochrobactrum sp. A44: CES85_4312Help
Entry
CES85_4312        CDS       T05040                                 

Definition
(GenBank) nickel import ATP-binding protein NikE
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
och  Ochrobactrum sp. A44
Pathway
och02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:och00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CES85_4312
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:och02000]
    CES85_4312
Transporters [BR:och02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    CES85_4312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 oligo_HPY SMC_N AAA_22 AAA AAA_29 NACHT AAA_16 AAA_24 AAA_33 Sigma54_activat Zeta_toxin DUF87 NB-ARC PRK FtsK_SpoIIIE NTPase_1
Motif
Other DBs
NCBI-ProteinID: ASV83532
UniProt: A0A248UAB5
LinkDB All DBs
Position
2:504093..505727
Genome map
AA seq 544 aa AA seqDB search
MTTPLVEIRNLSISFQREDQTLKVVEGINLTIYPGETMALVGESGSGKSVTARALIGLSG
PSAIVKADLFEIDGLNVLDYRDKQWRGLRGNKIGFVLQDALVSLDPLRRISQQLSDAFGT
TSFFRQPDVTDRSKALLRSVGIPDPDRRLLQYPHQLSGGLRQRALIATAVARSPSLLIAD
EPTTALDATVQKQILDLLAERRRAGHTLLLISHDLAVVSRLADRVLVMHNGRIVEEGPTK
QILNAPKEAYTRHLLEAVPSAGSRGYRLSPAQPHQPQVRVALPAKRIDESTNVLEAKGLF
KHYGKANTPLAVNDVSFSLKAGEALGIVGESGSGKTTVAKIVLGLTEPDQGTVHIDGKLW
SNLREEQRREQRAHMQLIAQDALSSFDPRYTVEKIVGESLDSVHIYGDERRKRVVEVLDA
VRLGSQFLKRYPRELSGGQRQRVAIARAFAPSPKLLIADEPVSALDVSVQAQVLDLLAEL
QAASGTSLLFISHDLGVVHHLTDRVLVMKDGRIVESGAVERVFSQPQHNYTRALLDAVPT
ISAA
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgccccttgttgaaatccgaaacctttcgatcagttttcagcgtgaagatcag
acattgaaagtcgtggaaggcatcaatctgaccatttatcccggtgagacgatggcgctt
gtcggagagtccggttcgggcaagtcggtgacggcacgagcactgatcggactttcaggt
ccaagtgcaatcgtcaaggctgaccttttcgagatcgatggtctgaatgtccttgattat
cgcgacaagcaatggcggggtttgcgcggcaacaagatcggttttgtcctacaggacgcg
ctggtttcgctcgatccgctacgtcgtatctcgcaacagctttccgacgccttcgggaca
acaagctttttccggcagccggatgtcacggatcgtagcaaggcattgctgcgctcggtc
ggcattcccgaccctgatcgcagattgctgcaatatccacatcagctttccggcggcttg
cggcaacgcgcactgatcgcaacagcggttgcgcgttcgccgtcgctgttgattgcggac
gagccaaccacagcgcttgatgcgacggttcagaaacagatacttgatctccttgcggag
cgtcgccgcgctggccacacacttcttctgatcagccatgatcttgccgtcgtctcgcgg
ctggcggatcgcgttctggtcatgcacaatggccggatcgttgaggaaggcccgacaaaa
cagatcctcaatgcgccgaaggaagcctatacccgacatttgcttgaagccgtaccgtcg
gccggatcgcggggctatcggctatcgccagcacagccgcaccaacctcaagtcagggtg
gccctgccagcaaagcgcatcgatgagagcaccaatgttctggaagccaaagggcttttc
aaacattatggcaaagccaacacgcctttggccgtcaatgatgtctcgttctcgctgaaa
gctggtgaagcgctcggcattgtcggagaatccggctctggcaaaaccactgttgcaaag
atcgttctgggactcacagaacccgatcagggtacagtgcatattgatggcaagctctgg
agcaatctgcgcgaggagcaacgtcgcgaacaacgtgcgcatatgcaactgattgcgcag
gatgcgctaagctcattcgacccgcgttatacggttgaaaagatcgtcggtgaaagcctt
gattcagttcatatctatggtgatgaacgtcgcaagcgcgtggtggaagtgctggatgcc
gtccgtttgggatcccagtttcttaagcgctatccccgtgaattgtcgggcggccagcgc
cagcgtgtcgccatcgcgcgtgcctttgcaccgagtccgaaacttctgatcgccgatgag
cctgtgagcgcgcttgatgtgtcggtgcaggctcaggtacttgaccttctggctgagcta
caagctgcctccggcacgtcacttctgttcatttcacatgaccttggcgtcgttcatcat
ctgacagaccgcgttctggtgatgaaagatggccgcattgttgaaagcggcgccgttgaa
cgcgtcttttcccaaccacagcacaattacacacgcgccctgctggatgccgttccaacg
atcagcgccgcttag

DBGET integrated database retrieval system