KEGG   Ochrobactrum sp. A44: CES85_4471Help
Entry
CES85_4471        CDS       T05040                                 

Definition
(GenBank) DNA ligase, ATP-dependent, PP_1105 family
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
och  Ochrobactrum sp. A44
Pathway
och03030  DNA replication
och03410  Base excision repair
och03420  Nucleotide excision repair
och03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:och00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CES85_4471
   03410 Base excision repair
    CES85_4471
   03420 Nucleotide excision repair
    CES85_4471
   03430 Mismatch repair
    CES85_4471
Enzymes [BR:och01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CES85_4471
    6.5.1.6  DNA ligase (ATP or NAD+)
     CES85_4471
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CES85_4471
DNA replication proteins [BR:och03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CES85_4471
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CES85_4471
DNA repair and recombination proteins [BR:och03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CES85_4471
   NER (nucleotide excision repair)
    Other NER factors
     CES85_4471
   MMR (mismatch exicision repair)
    Other MMR factors
     CES85_4471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N
Motif
Other DBs
NCBI-ProteinID: ASV83689
UniProt: A0A248UBH0
LinkDB All DBs
Position
2:657667..659286
Genome map
AA seq 539 aa AA seqDB search
MRAFAELLDRLVLTPQRNGKLRLLVDYFRTTPDPDRGLALAAITLDLELQSVKPAMLRAL
IAERSDPTLFAYSYDYVGDLAETISLIWPGPNETPAGANLPLSVVVHELQNASRREGPLL
VAGWLDLLGISERYALLKLVTGGLRIGVSARLAKQALADFGGVEVVEIEELWHGQAPPFS
ALFAWLEGHGSKPAATADAPFRPVMLATAFDEAEIPALDPSAYSAEWKWDGIRVQAVSEN
GVRRLYSRTGDDISGAFPDVLEAMDFEGSIDGELLVGYHGETGIETATFSDLQQRLNRKT
VSAKQLKEYPAFIRAYDLLQEGTQQTGEDLRPLPFSERRARLTRFIEKLDKRRFDLSPVL
QFNNFSELANLRLNPPHPVIEGVMLKRHDSAYVPGRPKGPWFKWKRDPFTVDAVVVYAQR
GHGKRSSYYSDFTFAVWTGAEDEPVLVPVGKAYFGFTDEELKLLDKFVRENTIERFGPVR
SVRAEPDHGLVVEVAFEGLNRSTRHKSGVAMRFPRFSRLRWDKPPREADRLETLETLLS
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctttcgcagaactcctcgaccggcttgtcctcacacctcagcgcaatggcaaa
ttgcggctgctggtcgactattttcgcaccacgcccgatcctgaccgcggtctggcactc
gcagccatcacgctcgatctggaattgcagagtgtcaaacccgcgatgctgcgcgcattg
atagccgagcgcagcgatcctacgcttttcgcctattcctatgattatgttggcgatctt
gccgaaacgatttcactgatctggcccggtccaaatgaaacgccagcgggtgccaatttg
ccgctcagtgtggtcgtgcatgaattgcaaaacgcctcgcgccgcgaggggccgctgctt
gtggcaggctggctcgatctgctaggcatttcagaacgatacgcgctgcttaagcttgtc
acaggtggtttgcgtatcggtgtttccgctcgtcttgccaaacaggcgctggcggatttt
ggcggcgtggaggtcgtcgaaattgaagaactttggcacggacaggcaccacccttttca
gcgctgttcgcatggcttgaagggcatggttcaaaacctgcagccactgccgatgcgccc
ttccggccagtcatgctggcaacagcctttgatgaagccgaaattccagcactcgatcca
tctgcctatagtgctgagtggaaatgggatggcattcgcgttcaggcggtatcggaaaat
ggtgttcgacggctttattcgcgcactggtgacgacatttcaggtgcttttcccgatgtg
ttagaagccatggattttgaaggctcgattgacggcgaattgctcgttggctatcacggt
gaaactggcattgaaaccgcaacgttttccgatttgcagcagagattaaaccgcaagacc
gtctcagcgaagcaattaaaggagtatcccgccttcatacgcgcctatgatcttttgcag
gagggcacgcagcaaacaggcgaagacctgcgtccattgcctttctctgaacggcgcgcg
cgacttacgcgcttcattgaaaagctcgacaagcgccggttcgatctatcgcccgtattg
cagttcaacaatttcagcgaactggcaaacctgcgcctaaacccgccccatccggtgatt
gagggtgtgatgctaaagcgccatgacagcgcctatgtgccggggcgccccaaagggccg
tggttcaaatggaaacgcgatccattcaccgttgatgctgtagttgtttatgcacaacgc
gggcacggcaaacgatccagctactactccgatttcacattcgccgtttggaccggagca
gaagatgaacctgttctggtgccagtaggaaaagcctattttggctttactgatgaggag
ttaaagcttctcgacaagtttgttcgcgaaaacacgattgagcgctttggtcccgttcgc
tcagtccgcgcggaaccagatcatgggctggtggttgaagttgcttttgaagggctgaac
cgttccacccgacacaagtcgggcgttgctatgcgctttccgcgcttttcacgtctccgc
tgggacaagccgccccgcgaagcggatcgacttgaaacattggagacactgctgagctga

DBGET integrated database retrieval system