KEGG   Ochrobactrum sp. A44: CES85_5699Help
Entry
CES85_5699        CDS       T05040                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
Organism
och  Ochrobactrum sp. A44
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ASV84895
UniProt: A0A248UDT3
LinkDB All DBs
Position
2:1868516..1870039
Genome map
AA seq 507 aa AA seqDB search
MSQTSIGGQPHGIRQPGAFYIGGEWVAPESGDRLDVVTPSTEEVFGRFAAANIQDINKAV
GAARIAFDEGPWPRLTHAERAEYLRALSKELSSRIPDLSNIWTSEVGVTCRIANASVPRS
AAVFDYYAGFAERFPFVERHQPRSGGNHGYLVHEPVGVVGAIVAWNGSLGLTVWKCAPAL
LAGCTVVVKASPESPGPAWVIAEAAAAVGIPSGVFNVVLADREVSEHLVRHPDVDKITFT
GSSAVGKRIASICGERVARCTLELGGKSAALILDDYDVEKAALSISQSARVLSGQICSSL
TRLIVPRTRQDQLIEALSAAFLSTKVGDPFDRETDMGPLASSRQRDRVESYIAKGRDEGA
RLVVGGKRPDRLNRGFYVEPTVFSDVDNAMTIARDEIFGPVLSVIPVDDDEQAIAVANDS
PYGLNASVFTDDADRAWEIARRLRSGTVGHNSFRTDFYIAAGGFKQSGLGREGGSEGLRG
FLEPKTIILDAEPTKGREQSNSTGALG
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaacatcaattggcggccagccgcacggcatccggcaacccggtgcgttttac
ataggtggtgaatgggtggcaccggagtctggtgatcgtctcgatgtcgttaccccttca
acggaagaggttttcggccggttcgcagcggcaaatatacaggatatcaacaaggcggtt
ggagccgcacgcattgcatttgacgaggggccgtggcctcgtttgacacatgccgaacgg
gcagaatatctcagggcattgtcgaaagaattgtcttcacgcattccggacctgagcaat
atctggacatccgaggtgggtgtgacatgcagaattgcgaacgcttccgtgccacgctct
gcagctgtcttcgactattacgccgggttcgccgaacgcttcccctttgtcgaaaggcat
cagccgcgcagtgggggcaaccatggctatcttgtccatgagccagtgggcgtcgtcggc
gcgatcgtcgcctggaacggctcgctggggctaactgtctggaaatgcgcgccagccctt
ttggcaggttgtacggtagtggttaaggcgtcgcccgaatcccccggtccggcctgggtt
atagctgaggccgctgctgcggtcggcattccgtctggtgtgttcaacgttgtgctcgca
gaccgcgaagtttcggagcatctcgttcgccatcctgatgtcgataagattacatttacg
ggctcgagtgccgtcggcaaacgcatcgcttccatttgtggcgaacgtgtcgcgcgctgc
acgctcgaactcggcgggaaatcggctgccctcattctcgatgattacgatgtggagaag
gctgccctatcgatttcccaatcagcacgtgtgttgtcgggacagatttgttcgtcactc
acgcggctcatagtgccacggacgcgtcaggaccagctcattgaagccctttcggcagca
tttctgtctacaaaggttggcgatccgttcgacagagaaacagatatggggccactcgcc
tcttcgcgccaacgagaccgggttgagagttacatcgccaagggccgggacgaaggggca
agactcgttgtgggcggaaagcgcccggaccggctgaataggggtttctacgtggagccg
actgtattttccgatgtcgacaacgcgatgacgattgccagagacgagatttttggcccc
gtgctcagtgtgataccggtcgatgatgacgagcaggcaatagccgttgccaacgatagt
ccttacggcctcaatgcgtccgtattcaccgatgacgcagaccgcgcatgggaaattgcg
cggagactgcgatcaggcactgtaggacataactcgttccgcacagatttttacatcgca
gcgggtggcttcaaacagtcaggtctgggccgtgaaggcggcagcgaggggctcaggggc
tttctggaacccaaaactattatcctcgacgcggaaccgacgaagggaagagaacagtca
aatagcacgggtgctttggggtaa

DBGET integrated database retrieval system