KEGG   Oceanihabitans sp. IOP_32: FEZ18_10030
Entry
FEZ18_10030       CDS       T06249                                 

Gene name
metH
Definition
(GenBank) methionine synthase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
oci  Oceanihabitans sp. IOP_32
Pathway
oci00270  Cysteine and methionine metabolism
oci00450  Selenocompound metabolism
oci00670  One carbon pool by folate
oci01100  Metabolic pathways
oci01110  Biosynthesis of secondary metabolites
oci01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:oci00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    FEZ18_10030 (metH)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    FEZ18_10030 (metH)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    FEZ18_10030 (metH)
Enzymes [BR:oci01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     FEZ18_10030 (metH)
SSDB
Motif
Pfam: Met_synt_B12 Pterin_bind B12-binding_2 B12-binding
Other DBs
NCBI-ProteinID: QFZ55105
UniProt: A0A5Q0JXB5
LinkDB
Position
2408913..2411585
AA seq 890 aa
MKVKQTKYMRLSGLEPLVLNENSNFINVGERTNVAGSRKFLRLIKEENYDEALDIARHQV
DGGAQILDVNFDDGLIDGKEAMIRFLNLIAAEPDICKVPIMIDSSKWEIIEAGLQVVQGK
CVVNSISLKEGEANFIWEAKQIKRYGAAVIVMAFDEVGQADTYERRIEIAKRSYDILVDK
VGFPSEDIIFDLNIFPVATGMEEHRRNAIDFIEATRWVRENLPNVSVSGGVSNVSFSFRG
NNGVREAMHSVFLYHAIQAGMNIGIVNPALLEVYDDIPKDLLEHVEDVILDRRDDATERL
LDFAETVKGSKKEAGADLSWRENPLQDRITHALVKGIDSYIVEDVEQARQEANSPIDVIE
GHLMTGMNVVGDLFGAGKMFLPQVVKSARVMKKAVGYLNPFIEAAKTDKQEPVGKILMAT
VKGDVHDIGKNIVSVVLACNNYEIVDLGVMVPPEKIIETAIRERVDAIGLSGLITPSLDE
MVYLAKEMQRNNLELPLLIGGATTSKAHTAVKIDTQYNNAVVHVNDASRAVTVVGDLLNK
KSSQDYVAKLKKDYDEFRTKFLKRGKEKSYISIEEARKRKYKIDWNATEIVKPNTLGIQV
LEQLSLKELLPFIDWSPFFRSWDLHGKFPDILTDKVVGEQATIMYEEAQRMIKVIIAKQL
FKPKAIFGLFEANSIHHDDISVIRKGKEIAVFRTLRQQLKKREGIPNHALADFIAPKDSG
KTDYLGLFSVGIFGAQELAESYKLKDDDYNAIMAQAIADRFAEALAEYLHKQIRMKHWGY
AANENLTNDDLIKESYKGIRPAPGYPACPDHLEKETIWELLDVEKRIGISLTESLAMWPA
AAVSGYYFANPEAKYFGLGKITDDQVTDYAKRKGITKAKARKWLHANIAE
NT seq 2673 nt   +upstreamnt  +downstreamnt
atgaaagtaaaacaaactaaatacatgcggttgtctggtttagaacctttggttttaaac
gaaaatagcaattttataaatgtaggtgagcgcactaatgttgctgggtctcgtaagttt
ttaagattgataaaagaagagaattatgacgaagctttagatattgcacgacatcaggtt
gatgggggtgctcagattttagatgttaattttgatgatggtttgattgatggcaaagaa
gccatgatacggttcttaaacctcattgcagccgagccagatatttgtaaagtgcccata
atgatcgatagctcaaaatgggagattatagaagctggacttcaagtggtgcaaggtaaa
tgcgttgttaattccatttctctaaaagaaggtgaagcgaattttatttgggaagccaag
caaattaaacgttatggtgctgcagtaattgtaatggcttttgatgaagtagggcaagcc
gatacttacgagcgccgtatagaaatagccaaacggtcttatgatattttagtagataaa
gtgggttttccttctgaagatattattttcgatttaaatatatttcctgtagccacaggg
atggaagaacatcgtagaaatgccatagattttattgaagccacacgctgggtacgtgaa
aacttaccaaatgtaagtgtaagtggaggcgtgagtaatgtgtcgttttcttttagagga
aataatggcgttcgcgaagccatgcactctgtgtttttatatcatgccatacaggcgggc
atgaatataggtattgttaaccctgcacttttagaggtttatgacgatattccaaaagac
ttgctagaacatgttgaagacgttattttagatcgcagagacgatgctaccgagcggctt
ttagattttgccgaaaccgtaaagggatctaaaaaagaagctggagccgatttgtcttgg
cgagaaaaccctttacaagacagaattactcacgccttagtaaaaggtatagattcttat
attgttgaagatgttgagcaagctcgacaggaagccaattcgccaatagatgttattgaa
ggacatttaatgacgggtatgaatgtcgttggcgatttatttggagctggtaaaatgttt
ttacctcaagttgtaaaatctgcaagggttatgaaaaaagccgtaggctatctcaacccc
tttattgaagcagcaaaaaccgataaacaagaaccggttggtaagatacttatggccact
gtaaaaggcgatgttcacgatattggtaaaaatattgtaagcgttgttttagcttgtaat
aattacgaaattgtggatttaggtgtcatggtgccgccagaaaaaattattgaaacggca
ataagagaacgtgtagacgctattggtttgtctggcttaattacaccatcattagatgaa
atggtatatttagccaaagaaatgcaacgcaacaatcttgaattacctttgcttataggg
ggagcaaccacatcaaaagcacatactgcagttaagattgacacccaatacaacaacgca
gtggttcatgtaaacgacgcctcacgtgccgtaaccgttgttggcgatttgttgaataaa
aaatcttctcaagactatgttgcaaagttaaaaaaagattatgatgagtttcgaacaaag
ttcttaaaacggggtaaagaaaaatcatatatttctattgaagaagccagaaaaagaaaa
tataaaattgattggaatgctaccgaaattgtaaaaccaaataccttaggtattcaggtg
ttagagcaattaagcctaaaagagttgttgccttttatagattggagtccgttttttaga
agctgggatttacacgggaaattccccgacattttaaccgataaggtggttggcgagcaa
gctacaattatgtacgaagaagcacagcgcatgattaaagttattattgcaaaacaattg
tttaaacctaaagcaatttttggcttgtttgaggcaaattcaattcaccatgatgacatc
tcagtgataagaaaaggaaaggaaatcgctgtttttagaaccttacgccaacaattaaaa
aaacgagaaggtattccaaaccacgcactagcagattttattgctcctaaagattctggg
aaaaccgattatttaggtttgtttagtgtaggtatttttggtgcacaagaattggccgaa
agctataagttaaaagacgatgactacaatgctattatggcacaagccatagcagataga
tttgcagaagccttggccgaatatctacataagcaaatacgcatgaagcactgggggtat
gctgctaatgaaaatttaactaatgacgatctgattaaggaaagctataaagggatccga
ccagcgccggggtacccagcatgtccagatcatcttgagaaagaaaccatctgggaatta
ttagatgtggaaaaacgaattggtatttcattaaccgaaagcttggccatgtggcctgct
gctgcagtgtcggggtattattttgctaatccagaagccaagtatttcggattagggaaa
attacagacgatcaggttaccgattatgctaaacgaaagggaatcactaaagcaaaagcc
agaaagtggttgcacgctaatattgcagagtaa

DBGET integrated database retrieval system