KEGG   Oceanispirochaeta sp. K2: EXM22_10880Help
Entry
EXM22_10880       CDS       T06177                                 

Gene name
ptsP
Definition
(GenBank) phosphoenolpyruvate--protein phosphotransferase
  KO
K08484  phosphotransferase system, enzyme I, PtsP [EC:2.7.3.9]
Organism
ock  Oceanispirochaeta sp. K2
Pathway
ock02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ock00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    EXM22_10880 (ptsP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ock02000]
    EXM22_10880 (ptsP)
Enzymes [BR:ock01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     EXM22_10880 (ptsP)
Transporters [BR:ock02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    EXM22_10880 (ptsP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP-utilizers_C PEP-utilisers_N PEP-utilizers HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: QEN08464
UniProt: A0A5C1QPF6
LinkDB All DBs
Position
complement(2398254..2400563)
Genome map
AA seq 769 aa AA seqDB search
MEFEPVLCDYYIIEVQNFTKSLKSISNKASLFESDGEMDGFLKEAVSLLMAEAGAATGSI
FIFDEASSELVFRVGYDKGEFWDTKRCSSKKIPRRFSLDDSEVGRAFKEDILHILHFPDP
DDQNLTISRIMVPVVRGPDKIGALIMSGPGSEVFDGVNKADLRRAASLLGDMLSEATAFM
VHSHMEPSFVRVPDSRVILGLKASEGLAEGVALPIWSDMDSVAEMIQESGDPEQELQVFE
TALLHSQDQLKRIQKSTSFGDTELVSMIFTAQMYMLKDKSFLGKMRHEISEGFSASKAVL
KVIASYADRFSSMKEARLAEKAQDVRDLGYRILSNMAQPEREGFNYNDQVVLSRHIFPSD
LFRLAVEGVAGVVLRGAGVTAHIAILARSLSVPLLISDDISLLEIPEGLPLLLDATNGKL
YVRPDEKTRKNVSEKHRLKKQIPGSYILKGHLSDGLSVSVHANINILKDAEDALREGAEG
IGLYRSEFPFILKNDFLSEEQQFRLYRSIVGIQNGKPIILRTADIGGDKLLQGRSESESN
PFLGVRGIRFSLANLEMFRDQIRAMLRAGYGADLGIMLPMVSGVEEILQARQEVELCIRQ
LEARGEPFNAHPKIGAMIELPSAAMSVRELAGVTDFLSIGSNDLIMYLLAVDRTNENLSH
LYRSHHPTVLRLLSSIIKEAVDEGRDISVCGDIASDPQLIPVLVGMGIRKLSVSPSQVEN
VKKRLLQFTHEETLQICREILEVRRLEDMDEFMKSLKLRYPYAEEGASS
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgaacctgttctctgtgattattatattatagaagtgcagaattttacaaaa
tcgctgaaaagcataagcaataaggcttccttgtttgaatcagatggggaaatggatggg
ttccttaaggaagccgtttctctcttaatggccgaagccggtgcggctactgggtccatc
tttatctttgatgaggcttcctccgaactcgttttcagagtcggctatgacaaaggggag
ttttgggatacaaagcgctgtagttctaaaaagataccccgccgcttctccctggatgat
tcggaggtcggtcgggcttttaaagaagatatccttcatatccttcattttcccgatccg
gatgatcagaaccttaccatctccagaatcatggttcccgttgtaagaggacccgacaaa
atcggagcccttatcatgtccggtcccgggtcggaagtctttgacggtgtaaacaaggct
gatttacgccgggctgcttcacttttgggagacatgctgtccgaagctacagcctttatg
gtccattctcatatggaaccctcctttgttcgtgttcccgactccagagtcatactgggg
ttgaaagcctcggaaggtttggctgaaggggtcgctcttcccatatggtctgatatggat
tctgtcgcagagatgattcaggagagcggagatccggaacaggaactgcaggtttttgaa
acggctttgcttcactcccaagatcaattgaaaaggatccaaaagagtacctccttcggt
gataccgagctggtctccatgatttttactgcccagatgtacatgctcaaagataagagc
tttctaggcaagatgaggcatgagatttctgagggtttttctgcctcaaaggcagtcttg
aaggtcatcgcgtcctatgccgacaggttttcctccatgaaggaagcccgactggccgag
aaagcccaggatgtgagagacctaggataccgtatcctttcaaatatggcccagcctgag
agagaaggattcaattataacgatcaggttgtcctgtccaggcacattttcccttcagat
ctttttcgtctggccgtagaaggggtggccggggttgtcctgcggggagccggtgtcacc
gctcatattgctattctggcccggtctctctcggttccacttctcataagcgatgatatt
tctcttttggaaattcccgagggcttgccccttctcctggatgctaccaacggaaaactc
tatgtccgtcccgatgagaaaaccaggaagaatgtctctgaaaaacacaggttaaaaaaa
cagattcccgggtcatatatactcaaaggccatctgtcggacggtctctctgtgtcggtt
catgccaatatcaatatcctaaaggatgccgaagatgctctgcgtgagggagccgagggg
atcgggctctacaggagtgaattcccctttatccttaagaatgactttttgtccgaagag
cagcaattccgcctgtatcgttctattgtaggaatccagaatggtaaacccatcatcctc
agaactgcagatatcggtggtgataagcttctccagggacggagtgaatccgaaagcaat
ccctttctaggggtccggggcatccgtttttcattggcgaatcttgaaatgttccgtgac
cagatccgggccatgctcagagccggatacggagcagatctgggaatcatgcttcccatg
gtctccggggtagaggaaatccttcaggcaagacaggaggtagagctctgcatccgtcag
ttggaggccaggggagaaccctttaatgcccaccccaaaatcggagccatgatcgaactg
ccttcggcggccatgtctgtccgggagttggcgggtgtgaccgattttttatctatcgga
tccaatgacctgatcatgtacctcctggccgtggacaggaccaatgaaaatttgagtcat
ctttacagaagccatcatcccacggttttgagactcttgtcttctatcatcaaagaagcc
gttgatgagggccgggatatttcggtctgcggtgatattgcttctgatccccagctgatt
cccgtactggttggtatgggtatccgcaagctcagtgtttctccctcccaggtagaaaat
gtcaagaaaaggctccttcaatttacccatgaagaaactctccagatttgcagggaaatc
cttgaagtgcgcagacttgaggatatggatgaattcatgaaatctctgaaactcagatat
ccctatgctgaagaaggtgcttcaagctga

DBGET integrated database retrieval system