KEGG   Oceanispirochaeta sp. K2: EXM22_18110
Entry
EXM22_18110       CDS       T06177                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
ock  Oceanispirochaeta sp. K2
Pathway
ock00052  Galactose metabolism
ock01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ock00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    EXM22_18110
Enzymes [BR:ock01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     EXM22_18110
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ThiF AlaDh_PNT_C 2-Hacid_dh_C ELFV_dehydrog UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: QEN09804
UniProt: A0A5C1QT52
LinkDB
Position
4002347..4003393
AA seq 348 aa
MKAAVLYGDNDLRYEDWTKPEAGTGEVLVKVKESGLCGSDIPRTIHGGAHFYPIVLGHEF
SGEIVALGEGVTKRKIGDRIACVPLIPDRNDPQSQKGNYSLSKGYKFIGSRIQGGWAEYV
SMPWENAVILPDSVSYTEGAFFEPITVALHALNIMKFEGGRDVAITGMGTIGLLALQCVR
AMGARKITVFDIDNSRLDLAKELGADLCLNTMDEGFKEEALAFTGGNGYEVCLETGGVPV
TEILCLDLAAPKGTVMFIGTPHKPVTLQPHEFEYINRKEIIVTGSWMNYSAPFPGWEWDM
ANYLFSNNKVKTEKLIDRKIPLSLASTAVADLLKPGAVKGKILFQCEK
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgaaagcagcagtattatacggagacaatgacctgcgttatgaggactggacaaaaccg
gaagcagggacaggagaagtgttggttaaggtgaaggaatcgggactctgcgggtcagat
attccccggaccatccatgggggagcccacttttatcccattgtcctgggtcatgaattc
tcgggagaaattgtcgctctgggtgaaggggttacaaaaagaaaaatcggagaccgtatc
gcctgtgttccgctcattcccgaccgaaacgatcctcagagccagaagggaaactactcc
ctctccaaggggtataagttcatcggatcacgtatccagggagggtgggctgagtatgtg
tctatgccctgggaaaatgctgtaatacttcctgactctgtaagctatacggaaggtgct
ttttttgaacccataacggtggcacttcatgccctgaatatcatgaaatttgaaggcggc
cgagatgttgctatcaccggcatgggcaccataggtctcctggctcttcagtgtgtcaga
gccatgggtgcccggaaaatcactgtttttgacatagataacagccgccttgatctggct
aaagagctgggtgcggatctctgtttgaacacaatggatgaaggctttaaagaagaagct
ctggcttttacagggggaaacggctatgaggtctgtcttgaaaccgggggtgttcccgtt
accgaaatcctctgtttggatttggctgctcccaaagggaccgtcatgttcatcggtact
ccccacaaacctgtaaccctacagccccacgagtttgaatacatcaaccgcaaagaaatc
atcgtcaccggcagctggatgaactactctgctcccttccctggatgggaatgggatatg
gcgaattacctctttagcaacaataaggtcaaaacagaaaagcttattgatagaaaaatt
cccttgagcctagcctccaccgcagtggcagatctactgaaaccgggggctgttaagggg
aaaatcctattccaatgtgaaaaataa

DBGET integrated database retrieval system