KEGG   Oceanisphaera avium: CBP12_00040Help
Entry
CBP12_00040       CDS       T04855                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ocm  Oceanisphaera avium
Brite
KEGG Orthology (KO) [BR:ocm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CBP12_00040
Enzymes [BR:ocm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CBP12_00040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like GIDA FAD_binding_2 DAO FAD_oxidored Thi4 NAD_binding_8 AlaDh_PNT_C Glutaredoxin FAD_binding_3 K_oxygenase Lycopene_cycl NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ART78735
UniProt: A0A1Y0CV28
LinkDB All DBs
Position
complement(6224..7774)
Genome map
AA seq 516 aa AA seqDB search
MLDTQLKNQLDSYLKNIVSPIEISVSSDASPKGQELTELANEISQLSPHISLQQVQATRS
PSLGIGAQGQSPRIHFAGVPLGHEFTSLVLALLQSGGHPSKVAPELQQQVRELKGEYHFE
TYISLSCQNCPDVVQALNLMATLNSNISHVMIDGALFQEEVNARQVMAVPAVYLNGEHFG
QGRMSLQEIINKLDTGAEQRQTEHLNKQAPFDVLVVGGGPAGVAAAIYAARKGIRTALVA
ERFGGQVQDTMGIENFISVPYTEGPKLVANLEQHVKDYGVEIITHQRVTDIRANNDNAGL
LVPLASGATLKSRSVIVAPGARWRELNVPGEQDYRNKGVAYCPHCDGPFYKGKRVAVVGG
GNSGIEAAIDLAGIVEHVTVLEFAEHLRADEVLQRKAKSLPNIDIITQAQTREVVGDGNK
VSGINYIDRASGEQQYLAVAGIFVQIGLVPNTEFLQGSAIELSPFGEVIIDAKGSTAIPG
VFAAGDATTVPYKQIVIAMGAGATAALSAFDYLIRS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttagatacccaattaaaaaaccaactggacagctatttaaaaaatatcgtctcgcct
atcgaaattagcgtgtccagtgatgctagccctaaggggcaggaattaactgagttggcc
aatgaaattagccagctttcaccgcacattagcctgcaacaagtgcaagcaactcgcagc
cccagcttagggattggcgcgcaggggcaaagcccacgcatccattttgcgggtgtccct
ctgggacatgagtttacgtctttggtattggcgctgttacaaagcggcggtcatccttca
aaggtggcgcctgagctacagcaacaagtgcgtgagcttaaaggcgaatatcactttgag
acttatatttcgctgtcttgccaaaattgtccggacgtagtgcaagcgcttaatttaatg
gccactcttaattccaatattagccatgtgatgatagacggcgccctgtttcaagaagaa
gtgaatgcgcgccaagtgatggccgtgcctgctgtttatttaaatggtgagcactttggt
caaggccgcatgagtttacaagaaattatcaataaattagatactggagccgaacagcgc
caaactgagcacttaaataagcaagccccgtttgatgtcttagtggtgggtggtggccca
gcaggcgtggcagcggctatttatgccgcccgtaaaggcattcgcaccgctttagtggcc
gagcgctttggcggccaggtccaagatacgatgggcatagaaaactttatttctgtgcct
tataccgaaggcccaaaattagtggcaaatcttgagcaacacgttaaagactacggtgta
gaaattattactcatcagcgtgtgacagatattagagcgaataacgataacgctggcctt
cttgtaccgctagccagtggcgctacgttaaaaagccgctcggtaatagtggcacccggc
gcacgctggcgcgagcttaatgtgcccggcgagcaagactatcgcaataaaggcgtggct
tactgcccacactgtgatggtcctttttataaaggaaagcgggtcgccgtagtcggtggc
ggtaattcaggcattgaagcagccatcgacttagcaggcatagtagagcatgtcaccgtg
ttagagtttgctgagcacttgcgcgccgatgaggtcttgcaacgtaaagccaaatcgctg
cctaatattgacattattactcaggctcaaactcgcgaagtggtgggcgatggcaataaa
gtcagtggtataaattatatcgaccgcgcaagtggcgaacagcaatacttggcagtggca
ggcatttttgtgcaaattggactggtgcctaacaccgagtttttacaaggttccgctatt
gagcttagtccttttggcgaagtcattatcgatgctaaagggagcactgccataccaggc
gtattcgctgccggtgatgccactactgtgccttataaacaaatagtgattgctatgggc
gccggcgccaccgccgctctcagtgccttcgattatttgattagatcctaa

DBGET integrated database retrieval system