KEGG   Oceanisphaera avium: CBP12_11265Help
Entry
CBP12_11265       CDS       T04855                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ocm  Oceanisphaera avium
Pathway
ocm00620  Pyruvate metabolism
ocm00680  Methane metabolism
ocm01100  Metabolic pathways
ocm01120  Microbial metabolism in diverse environments
ocm01200  Carbon metabolism
Module
ocm_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ocm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CBP12_11265
  09102 Energy metabolism
   00680 Methane metabolism
    CBP12_11265
Enzymes [BR:ocm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CBP12_11265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 SIKE DUF413
Motif
Other DBs
NCBI-ProteinID: ART80652
UniProt: A0A1Y0CZ98
LinkDB All DBs
Position
complement(2457917..2460559)
Genome map
AA seq 880 aa AA seqDB search
MDNHAPLRANVGLLGQLLGEAIKDHLGAEFLDKIETIRQLAKSARQGNEQDETRLIDTLK
QLSDDELLPVARAFSQFLNLANVAEQFHTISRQTQRNAGAGPIHEVLQRLKAAQIEPERI
TAALSELDIDLVLTAHPTEVTRRTFIHKHVQLNDCLAALELDLPSNEHAELIARIEQLIT
QGWHSKEIRSQRPTPVDEARWGFAVIENSLWPALPQFMRQLEQQTQAELGVRLPLDAAPI
RFTSWMGGDRDGNPFVTAQVTEEVLLLGRWVASSLFLSDIQELVSELSMSEASDELILAS
QSLTPSRGESDEPYRALLRKLREDLRETLLHLNAKVQGQNTDARDLITHNEQLRQPLELC
YRSLQACGLGKIADGLLLDVIRKVACFGIHLLKLDIRQDGERHAKALAEITRYLGLGDYS
EWSEADKQAFLLNELASRRPLLPHHWQASADTQEVLATCQVIAQHPPEAFGIYIISMASA
PSDVLAVQLLLKENGVDFALPVAPLFETLDDLNKGAEVIKQLYSLPWYRGYLAGRQYVMI
GYSDSAKDAGMMAAGWAQYSAMEKLVALSEQAQIKLTLFHGRGGSLGRGGGPAHQAILAQ
PPGSTQGGLRVTEQGEMIRFKFGLPKVALDSLALYASAVLEANLLPPPEPEPQWRKIMDT
LSEVSCAHYRALIRDEPDFVPYFRAATPELELGKLPLGSRPAKRKADGGVESLRAIPWIF
AWTQNRLMLPAWLGAHKGLAAVIAEGQESTLLAMNKGWPFFRARLDMLEMVFLKTDISLA
AYYDALLVPDELKPLGKRLRNELRDSMALILQLKEQAELLVSEPWIKESIKLRNPYTDPL
NVLQAELLKRSRQQGDIHPVLDQALMVTIAGIAAGMRNTG
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atggataatcatgcaccactaagggcaaacgttggcctgttggggcaattactgggcgag
gcgattaaagatcatctcggcgcggagtttttagataaaatagaaactattcgccaatta
gctaagtctgcccgtcaaggtaatgagcaagacgaaacccgattaatcgacaccttaaaa
caactaagtgatgacgagctcttgccagtggcgcgcgcctttagccagtttttaaactta
gccaatgtagctgaacaatttcatactatttctcgccaaacgcagcgcaatgccggcgcg
gggccaatacatgaagtattacaacgtcttaaagcggcgcagattgaacctgagcgcatt
acggcagcgctcagcgagctcgatatcgacttagtgctaaccgcacaccccacagaagtt
acccggcgcacttttatccataaacatgtgcaacttaatgactgtttagccgcacttgag
ctcgatttgcccagtaacgaacacgctgagctaatagcgcgtatcgagcagctgatcacc
caaggttggcacagtaaagaaattcgctctcaacgtcccactcccgtagatgaagcacgc
tggggctttgcggttattgaaaatagcctgtggcctgccctgcctcagtttatgcgccaa
ctcgaacaacaaacccaggccgagctaggcgttaggctgccgctggatgcggctcctatt
cgttttacttcttggatgggcggcgatcgcgacggtaacccttttgtcaccgctcaggta
acagaagaagtgttgttattaggacgctgggtggctagttcgttatttttaagtgacatt
caagagctggtttctgagctctctatgtcagaagctagcgatgaacttatattagccagc
caatccctcacaccgagtcgtggagaaagtgatgagccttatcgcgcattgctgcgaaaa
ctgcgcgaagatttacgagaaacactgctgcatttgaatgctaaggtacaaggacaaaat
accgatgcccgagatttaattacccacaacgagcagctgcgccaacctttagagttatgt
tatcgctcactgcaagcttgcggattgggcaaaattgccgatggcttactgctggatgtc
attcgtaaagtggcctgctttggtattcatttacttaaattagatattcgccaagatggc
gagcgccatgcaaaagcactggccgagatcacccgttatttaggattaggtgattacagt
gaatggagcgaagcagataaacaggcttttttactaaatgaattggcctcccgccggcct
ttgctgcctcaccattggcaagccagtgccgacactcaagaagtgctagcaacttgccaa
gttattgctcagcacccgccagaggcctttggcatttatattatttctatggctagcgcg
ccatcggatgtattggcagtacagctattactaaaagaaaatggtgtggactttgcgcta
ccggtggcgcccttatttgaaaccctcgatgacttaaacaagggcgccgaggtcattaag
cagctctatagcttgccttggtatcgtggctacctagcaggtcgccaatacgtgatgatt
ggctattccgactcggcaaaagatgccggcatgatggccgccggctgggcccaatatagc
gctatggaaaaactggtagcattaagtgagcaagcacaaattaagctcactctttttcat
ggtcgaggtggtagcttagggcgcggtggcggcccagctcatcaagcgattttagcgcag
ccgccgggctcaactcagggcggcttaagggtgacggaacaaggggaaatgatccgcttt
aagtttggtttaccaaaagtagcgcttgacagcttagcgctttatgccagtgccgtatta
gaggccaacttattaccaccgcccgagccagagccacaatggcggaaaataatggatacc
ttaagtgaggtgtcgtgtgctcattatcgagcgcttatccgtgacgagccagactttgtg
ccctactttcgcgccgccactccagagttagagctaggcaaactgccgctgggctcacgt
cccgccaagcgaaaagccgatggcggcgtagaaagtttgcgcgccatcccttggattttt
gcctggacacaaaatcgactgatgctccctgcttggctgggagcgcataaaggcctagca
gcagtcattgccgagggtcaagaaagtaccctgctagcgatgaacaaaggctggccattt
tttagagctcggctcgatatgctagaaatggtgtttttaaaaactgatattagcctagcc
gcctattacgatgcactattagtacctgatgagctaaagcctttgggtaagcggttgcgc
aatgagctgcgcgatagcatggcgcttattttacaactgaaagaacaagctgagttatta
gtcagtgaaccttggataaaagagtccattaagctacgtaatccctacacagatccgtta
aatgttttgcaggccgagctattaaaacgctcccgccagcaaggagatattcatccggta
ttagatcaagcactcatggtgaccatcgccggtatcgcggcagggatgcgtaatacggga
tag

DBGET integrated database retrieval system