KEGG   Oceanisphaera avium: CBP12_12330Help
Entry
CBP12_12330       CDS       T04855                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ocm  Oceanisphaera avium
Pathway
ocm00473  D-Alanine metabolism
ocm00550  Peptidoglycan biosynthesis
ocm01100  Metabolic pathways
ocm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ocm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CBP12_12330
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CBP12_12330
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CBP12_12330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ocm01011]
    CBP12_12330
Enzymes [BR:ocm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CBP12_12330
Peptidoglycan biosynthesis and degradation proteins [BR:ocm01011]
 Precursor biosynthesis
  Amino acid ligase
   CBP12_12330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATPgrasp_Ter GARS_A
Motif
Other DBs
NCBI-ProteinID: ART80845
UniProt: A0A1Y0D157
LinkDB All DBs
Position
2668908..2669825
Genome map
AA seq 305 aa AA seqDB search
MTSFGKVAVLFGGHAAEREVSLRSGAAVLKGLRNAGVDAHGIDTKDYALAELKTEGFERA
FIVVHGRGGEDGALQGALEYLGLPYTGSRVLGSALAMDKIRTKQVWKTLDLPTAEFSVVH
RGQFKAEDASALLAKFAGPIFVKPANEGSSIGMTKAVDAPTLIAAIEEAFKFDAQVLLER
FIDGEEYTVSILGEQALPAIRLRTTHDFYDYSAKYQSGDTEYLCPCGLSETEEKALGELC
VAAFKAVDASGWGRVDVMRDSQGNWCLLEVNTVPGMTETSLVPKAAKVAGLSFEQLVVAV
LEQAY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgacatcatttggtaaagtagcagtattatttggcgggcatgcagcagagcgcgaagtg
tcattacgctcgggagcggccgtgttaaaggggctgcgcaatgcgggtgtggatgcccat
ggtatcgataccaaagactatgcgctagctgagcttaaaaccgagggctttgagcgagct
tttatcgtggtacatggccggggcggggaagatggtgcgctgcaaggggcattagaatat
ttaggtctgccttatacaggctcgcgcgtgcttggctcggcactggccatggataaaatc
cgcaccaaacaagtctggaaaaccttagacttacccactgcagagtttagcgtggtgcat
cgtggccagtttaaggctgaagatgcgagtgcgctattggccaaatttgccggccctatt
tttgtaaagcctgctaatgaaggctcaagtattggcatgactaaggcggtagatgcacct
accttaatcgccgccattgaagaagcgtttaaatttgacgcacaagtgctgttagagcgc
tttatcgatggcgaggaatatacggtgagtattttaggcgagcaggcattgcccgctatc
cgtttgcgtaccactcatgatttctatgattactcggctaagtaccaatccggtgatact
gagtacttatgcccttgtggtttaagtgaaactgaagaaaaagcactgggcgagctgtgt
gtcgccgcctttaaagcggtggatgccagtggttggggacgcgtagatgtgatgcgtgac
agccaaggtaactggtgtttattggaagtgaatacggtccctggcatgactgaaaccagt
ttggtgcccaaagcggctaaagtagccggcttatcgtttgagcaattagtggtggcggtg
ctggagcaggcatactga

DBGET integrated database retrieval system