KEGG   Oceanobacillus sp. 160: CUC15_04165Help
Entry
CUC15_04165       CDS       T05570                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ocn  Oceanobacillus sp. 160
Pathway
ocn00970  Aminoacyl-tRNA biosynthesis
ocn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CUC15_04165
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ocn03029]
    CUC15_04165
Enzymes [BR:ocn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CUC15_04165
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CUC15_04165
Mitochondrial biogenesis [BR:ocn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CUC15_04165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AXI08206
UniProt: A0A345PDX6
LinkDB All DBs
Position
828579..830009
Genome map
AA seq 476 aa AA seqDB search
MNFETIIGLEVHVELKTKSKIFSPSVNEFGSDPNTNVNPIDLGYPGTLPVLNEEAVNFAM
KAAMALNCEIATNTKFDRKNYFYPDNPKAYQISQFDQPIGENGWIEIEVNGKKKRIGITR
LHLEEDAGKLTHGDDGYSYVDFNRQGTPLIEIVSEPDMRSPEEAYAYLEKLKNIIQYTGV
SDVKMQEGSLRCDANISLRPIGQEKFGTKAELKNLNSFSFVQKGLEFEEKRQEKVLLSGG
EILQETRRYDEKTKETILMRVKEGSDDYRYFPEPDLVPLYIDEAWKERVRSEIPELPDAR
KQRYVADLGLSEYDAEVLTSTKQMSDFFEEAVDHGADVKQASNWLMGEVSAYMNKHLKEL
NELAITPEALAKMIQLIEDGTISSKIAKKVFAELVENGGDPEQIVKEKGLVQISDPAQLQ
EIVNKILDENEQSIIDFKAGKGKALGFLVGQIMKATKGQANPPMVNKILGEEIKKR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaaacaattattggactagaggtacacgtagaattaaaaacaaaatcaaaa
attttcagtccgagtgtgaatgaattcggatctgacccaaatacgaatgtaaacccaatt
gatcttggatacccagggacacttccggtgctaaatgaagaagcggtaaactttgcaatg
aaggcggcaatggcactgaactgtgagattgcaacgaacacaaaatttgaccgtaaaaac
tatttctatccagataatccgaaagcatatcaaatctctcaatttgatcagccaattggt
gagaatggctggattgaaatcgaagtaaatggcaagaaaaaacgaattgggattactcgt
cttcatttagaagaggatgctggtaaactaacacatggtgatgatggttattcctatgtt
gactttaaccgacaaggtacaccattaatcgagattgtgtctgaaccagatatgcgctca
ccagaagaagcatatgcatatttagaaaagctgaaaaacattattcaatatactggtgtt
tctgatgtaaaaatgcaggaaggttcattaagatgtgatgctaatatttcgcttcgccca
attggccaagagaaattcggtacaaaagcagaattaaaaaacttgaactccttctcattt
gtacaaaaaggacttgagtttgaagagaagcgccaagaaaaggttttattatcaggtggc
gaaattttacaagaaacacgccgttatgatgaaaaaacaaaagaaacgattctaatgcgc
gtgaaggaagggtcagacgattatcgttacttccctgaaccagaccttgttccactttat
attgatgaagcatggaaagaacgcgttcgcagtgaaattccagagcttcctgatgcacgt
aaacaacgttatgttgcggaccttggattatctgaatatgatgcagaagtattgacaagc
acaaagcaaatgtctgacttctttgaagaagcggttgaccatggtgcagatgtaaaacaa
gcatcgaactggctaatgggagaagtttctgcttatatgaacaagcatttgaaggaatta
aacgagctagcgattacgccagaagccttagcgaaaatgattcaactaattgaagatggt
acgatttcatcgaaaatcgctaagaaggtcttcgcagagctagttgaaaatggtggagat
ccggaacaaatcgtgaaggaaaaaggtcttgttcaaatttctgacccagcacaactccaa
gaaattgtgaataaaatcttagatgaaaatgaacaatcgatcattgactttaaggctggt
aaaggaaaagcgcttggcttcctagtcgggcaaattatgaaggctacaaagggacaagca
aatccaccaatggttaataaaatattaggtgaagaaattaaaaagcgatag

DBGET integrated database retrieval system