KEGG   Oceanobacillus sp. 160: CUC15_07355Help
Entry
CUC15_07355       CDS       T05570                                 

Definition
(GenBank) competence protein
  KO
K02250  competence protein ComK
Organism
ocn  Oceanobacillus sp. 160
Pathway
ocn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ocn00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CUC15_07355
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocn03000]
    CUC15_07355
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ocn02044]
    CUC15_07355
Transcription factors [BR:ocn03000]
 Prokaryotic Type
  Other transcription factors
   Others
    CUC15_07355
Secretion system [BR:ocn02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   CUC15_07355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK
Motif
Other DBs
NCBI-ProteinID: AXI11125
UniProt: A0A345PM95
LinkDB All DBs
Position
1462887..1463420
Genome map
AA seq 177 aa AA seqDB search
MMKDFYSPYYEVRPLTMAIVAEKNQKGEPITRVLEEEIEYVVDFPPSKVVDYACKFFGSS
LRGRQEGTLDICGITHKAPISIDPLSGMYFFPTTSPKNLRCSWIAHSHIDQINKTGENDT
EFIFKNGKRIILRVSYGSMLNQLQRTAQYRFLLDNRIKYLQQRKAGMVAEPSQGAHE
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagatttttactctccatattatgaagtaagaccactaacgatggcaattgta
gctgaaaagaaccaaaaaggcgagcctattacgagagtattagaggaagaaatagaatat
gttgttgattttcctcctagtaaagtagtggactatgcttgcaagttttttggatcgagt
ctcagaggcaggcaagaaggaacattagacatatgtggaattacgcataaagcaccaatc
tctattgatcctttaagtggaatgtacttttttccgacaacttctcctaagaacctcaga
tgttcatggattgcacactcacacattgatcaaataaacaaaacaggagaaaatgatact
gaattcatttttaaaaatggcaagaggattattcttcgcgtctcttatggatcaatgtta
aaccagttgcaacgaacagcacaataccgctttttgctcgacaatcgaattaaatattta
cagcagcgaaaggctgggatggtggcagagccttcacaaggagctcatgaatga

DBGET integrated database retrieval system