KEGG   Oceanobacillus sp. 160: CUC15_08490Help
Entry
CUC15_08490       CDS       T05570                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ocn  Oceanobacillus sp. 160
Pathway
ocn00010  Glycolysis / Gluconeogenesis
ocn00020  Citrate cycle (TCA cycle)
ocn00620  Pyruvate metabolism
ocn01100  Metabolic pathways
ocn01110  Biosynthesis of secondary metabolites
ocn01120  Microbial metabolism in diverse environments
ocn01130  Biosynthesis of antibiotics
ocn01200  Carbon metabolism
Module
ocn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ocn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CUC15_08490
   00020 Citrate cycle (TCA cycle)
    CUC15_08490
   00620 Pyruvate metabolism
    CUC15_08490
Enzymes [BR:ocn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CUC15_08490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 HlyD_2 DUF896 ATP-synt_ab_Xtn DUF2118
Motif
Other DBs
NCBI-ProteinID: AXI08952
UniProt: A0A345PG22
LinkDB All DBs
Position
1676062..1677330
Genome map
AA seq 422 aa AA seqDB search
MAFEFKFPDIGEGITEGEIVKWFVNEGDEVKEDDTLCEVQNDKAVVEIPSPVDGTVKKIH
VAEGEVATVGNTFISLDAEGYESEEPAEEAKEEAPKAETKSEEKPAAESAPAEESDGKRV
IAMPSVRKYARENDVNIQAVSGTGKNGRVLKEDIDNYLNGGQSLEATQAEESTDKSTDSK
QAPVVSEGQYPESREKMTSIRKAIAKAMVNSKSKAPHVTLMDDVEVSALVAHRKKFKAVA
ADQGIKLTFLPYVVKALVSASKKYPILNSYIDDATDEIVEKHYYNVGIAADTDRGLLVPV
VKNADRKSIFEISQEINELAVKARDGKLTPDEMKGASNTISNIGSAGGQWFTPVINYPEA
CILGIGRIAEKPIVKDGEIVIAPVLALSLSFDHRIVDGATAQNALNQIKRLLNDPQLIMM
EA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaatttaagttcccagatattggtgaaggaatcacagaaggtgaaattgta
aagtggttcgtaaatgaaggcgatgaagttaaagaagacgatacactatgtgaggttcaa
aacgataaagctgtcgttgaaattccttctccagtagatggtacagttaagaaaatccat
gttgcagaaggtgaagtagcaactgttggaaatacatttatttcattagatgctgaagga
tatgaatccgaagaaccagctgaagaagcgaaggaagaagcacctaaagctgaaacgaaa
tcagaagaaaaaccagcagcagaatcggcaccagctgaagaatctgatggcaaacgtgtt
attgcaatgccttctgttagaaaatatgctcgtgaaaacgatgtgaacattcaagcagtt
tcaggtactggtaaaaatggtcgtgttctaaaagaagatatcgacaattatctaaatggt
ggccaatctttagaagctactcaagcagaggaatctactgataagagcactgattctaaa
caagctccagttgtttcagaaggtcaataccctgaatcacgtgaaaagatgacaagtatt
cgtaaagctattgctaaagcaatggttaactctaaatcaaaagcaccacatgttacatta
atggacgacgtggaagtgtctgcattagttgcacaccgcaagaaattcaaagcagttgca
gctgatcaaggaattaaattaacattcttgccatacgttgtgaaagctttagtttcagca
tctaagaaatatccaattctaaattcttatattgatgatgctactgacgaaatcgttgaa
aaacattattacaatgttggtattgctgctgatacagatcgcggattacttgtaccagtt
gttaaaaatgctgaccgcaaatcaatctttgagatttctcaggagataaatgaattggca
gttaaagctcgtgatggtaaacttacaccagatgagatgaaaggcgcttcaaataccatt
tcaaatattggttctgctggtggtcaatggtttacacctgtaattaactacccagaagca
tgtattcttggtatcgggcgaattgctgagaagccaatcgtaaaagatggtgaaatcgta
attgctcctgtccttgcattatcacttagctttgatcatcgtatcgttgatggtgcaaca
gcacaaaacgctttaaatcaaatcaaacgattactaaatgatccacaattaattatgatg
gaggcgtaa

DBGET integrated database retrieval system