KEGG   Oceanobacillus sp. 160: CUC15_11280Help
Entry
CUC15_11280       CDS       T05570                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ocn  Oceanobacillus sp. 160
Brite
Enzymes [BR:ocn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CUC15_11280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AXI09468
UniProt: A0A345PHI8
LinkDB All DBs
Position
complement(2213193..2213804)
Genome map
AA seq 203 aa AA seqDB search
MAKFELPELPYAYDALEPTIDKETMNIHHTKHHNTYVTNLNGALEGLADLQEKSLEELIS
NLDAVPESARTAVRNNGGGHANHSLFWKLLSPNGGGEPTGELAEKINAKFSSFDTFKEEF
AKAATTRFGSGWAWLVLNKGELEVTSTPNQDSPLMEGKTPLLGLDVWEHAYYLNYQNKRP
DYISAFWNVVNWDEVAKNYNEAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatttgaactacctgaattaccatatgcatatgacgcattagaaccaacaatc
gacaaagaaacaatgaacattcatcatacgaaacatcacaacacgtatgttactaactta
aatggtgcattagaaggtttagcagatcttcaggaaaaatctcttgaggaattaattagt
aatttagacgctgtacctgagagcgctcgtactgctgtacgaaataatggcgggggacat
gctaaccacagccttttctggaaattattatcaccaaatggcggtggcgaaccgactggc
gaattagcagagaaaatcaatgctaaattcagtagttttgatacatttaaagaagaattt
gcaaaagctgctacaacccgttttggttcaggttgggcatggttagttcttaataagggc
gagctggaagtaacaagcacaccaaaccaggattcaccactaatggaaggtaaaacacct
ttattaggtcttgatgtatgggagcatgcttactaccttaactatcaaaacaaacgccca
gattacatctcagcgttctggaatgtagtaaattgggatgaagttgctaaaaactataac
gaagccaagtaa

DBGET integrated database retrieval system