KEGG   Oceanobacillus sp. 160: CUC15_11845Help
Entry
CUC15_11845       CDS       T05570                                 

Definition
(GenBank) TIGR04086 family membrane protein
Organism
ocn  Oceanobacillus sp. 160
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3792
Motif
Other DBs
NCBI-ProteinID: AXI09573
UniProt: A0A345PHU3
LinkDB All DBs
Position
2323288..2323668
Genome map
AA seq 126 aa AA seqDB search
MQRNLFTALLYGWIFVFSFILLSSIILALLFRFTVFNENSLSWIALAIGFITLFIGGFIA
GAKGKMKGWMIGGFTGLGFSLFTFLVQYLGYQHGFSMEQSLTHLGYLLAAVIGGVIGVNI
FGSRSE
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaggaatctctttactgctttattgtatgggtggattttcgtatttagttttata
ttactttcaagcattattcttgcattattatttcgatttacagttttcaatgaaaactcc
ctatcatggattgcacttgctattgggtttataactttattcattggtgggttcattgct
ggagcaaaaggaaaaatgaaaggctggatgatcggtggatttacaggattagggttttcg
ctatttacctttctagtacaatatttaggctaccagcacggattctcaatggagcagtcc
ctaacccacttaggttatctgctagcagcagtcatcggcggtgtaatcggagtaaacatc
tttgggtcacggagtgagtag

DBGET integrated database retrieval system