KEGG   Oceanobacillus sp. 160: CUC15_12530Help
Entry
CUC15_12530       CDS       T05570                                 

Definition
(GenBank) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
ocn  Oceanobacillus sp. 160
Pathway
ocn00270  Cysteine and methionine metabolism
ocn00330  Arginine and proline metabolism
ocn00410  beta-Alanine metabolism
ocn00480  Glutathione metabolism
ocn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CUC15_12530
   00330 Arginine and proline metabolism
    CUC15_12530
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CUC15_12530
   00480 Glutathione metabolism
    CUC15_12530
Enzymes [BR:ocn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     CUC15_12530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Methyltransf_25 Methyltransf_23 Methyltransf_12 MTS Methyltransf_11 AAA_31 Methyltransf_31 Methyltransf_30
Motif
Other DBs
NCBI-ProteinID: AXI09698
UniProt: A0A345PI68
LinkDB All DBs
Position
complement(2463848..2465401)
Genome map
AA seq 517 aa AA seqDB search
MNEEAIRKSTIIYWSSGIVSICGIIFEVLFGALGSYILGDGVKQYTLTISLFLTGMGIGA
SLSEKVMKNLILSFIWVEFSVGLIGGFSSFTMFGITAYAPAGTDAFYLYFITILVGALTG
FELPILIRKANEIGVKLNKSTARVLFSDYAGGLIGGLLFVFLLRPQFGMVKSAFLVGCVN
VLVALTVLWLFRKEIRKFLVHAICGIVILVALIIGLLFGEAAAFNFEQKLYQDPILLMEE
TNYQKIILTQGADEDVRLYLNGSLQFSSADEYRYHEVLVHPTIAYAENPEKVLILGGGDG
IAAKEVLKYDEVKHITLVDLDPAMTELANTNERLLKLNEGALQNDKVDVKNMDAFQFLEE
SEEWYDVIIIDLPDPNDESLNKLYTKEFYSLVRNHLLPGGAAMIQATSPVFATEVYWTIA
ETVISAGLYTENLHVDVPSFGNWGFVMASRGKIDLQTVDITIPTRFLKTDLLPSLTAFGA
DEDSIIEDKNGDSVTLKPNTLIDPHLIQLYENAWKNY
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgaggaagcaataagaaaaagcacgattatttattggtcatctggaattgtttca
atttgtggcattatctttgaggttctgtttggtgcgttaggatcgtacatattaggtgat
ggagtcaaacagtatacattaacaatttcgctgtttttaacgggaatgggaattggtgca
agcctgagtgagaaggtaatgaaaaatctaatactttcctttatttgggttgaattcagt
gtagggctgatcggcggattttccagctttacgatgtttgggattaccgcatatgcgcct
gctggaaccgatgcattttatttatatttcattacgattttagtcggtgcgttaaccgga
tttgagttgccaatccttatccgcaaggcaaatgaaattggtgtgaaattaaataagagt
acagcgagggtactgttttctgactatgctggtggactaattggtgggctgctattcgtt
ttcctattacgcccgcagtttggcatggtgaaatcggcatttctagtaggctgtgttaat
gttcttgtagcattaaccgtgttatggctattccgaaaagaaatacgtaagttcttggta
catgccatttgtgggattgtgatattagtcgctttaatcattggtttgctattcggcgag
gctgctgcctttaattttgaacaaaagctatatcaggacccaattttacttatggaagaa
acaaattaccagaaaattattcttacacagggtgcagatgaggatgtgcggctttattta
aatggctccttgcaatttagctcggcagatgaatatcgttaccatgaggtactcgtccac
ccgacaattgcctatgcagagaatccggaaaaagtgctgattctaggtggtggtgacggg
attgccgcaaaggaagtactgaaatatgatgaagtcaagcatattactttggtcgacctt
gatccagcgatgacagagcttgcgaatacgaatgagcggctgctgaaattaaatgaaggt
gctttgcaaaatgataaagttgatgtgaaaaatatggatgcctttcagtttttagaagaa
tcagaggaatggtacgatgtaattattatcgatttaccagatccaaatgacgaaagctta
aataagctgtacacgaaggaattttattcacttgtccgtaatcatttgcttccaggtgga
gcggcgatgattcaggcgacaagccctgtgtttgcaactgaagtatattggacaatagct
gaaaccgtcatctcggcgggattatatacggaaaatcttcatgttgatgtaccaagcttc
ggcaactggggatttgtgatggcaagtcgtgggaagattgatcttcaaacagttgatatt
accatcccaactcgatttttgaaaacggatctgctcccgagtttaacggcttttggtgct
gacgaggactcgattatcgaggataaaaacggtgattcagttacattaaagcctaataca
ttaattgatccacatttaattcaactatatgagaatgcatggaaaaactattaa

DBGET integrated database retrieval system