KEGG   Oceanobacillus sp. 160: CUC15_14075Help
Entry
CUC15_14075       CDS       T05570                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ocn  Oceanobacillus sp. 160
Pathway
ocn00564  Glycerophospholipid metabolism
ocn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ocn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CUC15_14075
Enzymes [BR:ocn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CUC15_14075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 NAD_binding_8 FAD_binding_3 Pyr_redox_2 3HCDH_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AXI09982
UniProt: A0A345PJ02
LinkDB All DBs
Position
complement(2773591..2775255)
Genome map
AA seq 554 aa AA seqDB search
MTILSSFNRKDTFNKLENESLDVLIVGGGITGAGIALDAVTRGLKVGLVEMQDFAGGTSS
RSTKLVHGGLRYLQQFEIKMVAEIGKEREIVYENGPHVTTPEWMMLPFHKGSTLGPFTTN
IGLRVYDFLAGVKKSERRKMFSPEQALQKEPLIKKDGLKGAGYYVEYKTDDARLTIEVMK
KAVERGAHAINYAKVTEFIYDESHKISGITVEDQITQETYSLHAKKIINAGGPWVDELRE
IDGSKKGKTLHLTKGIHLVFPKEVFPLEQAIYFDTPDGRMIFAIPRDNKTYVGTTDTTYE
GDIAHPVMTEADETYVLDAINYMFPSLNMQKKDVESSWAGIRPLIEEEGKNSPSEISRKD
EIFVSDSGLISMAGGKLTGYRKMAEQAVDTVVEQLKTEEGILYTKSETIDLPISGGDVGG
SKGYQTFLQRKVADGVALGLNKTTALDLASIYGSNVDTLYDIYQDRKEEAEKEGIDPAVF
AKLIYAMENEAAYKPVDFFIRRTGALFFDINWVRRNKENVIQYMAKTLRWSGEQKQRYIA
ELEQLLHEAVTPTI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgacgatattatcaagcttcaatcgtaaagatactttcaacaaattagaaaacgagtct
ttagatgtattaatcgttggtggcggtattactggtgcaggaattgctttagatgccgta
acacgaggattaaaagttggcctagtggaaatgcaggatttcgctggtggaacctccagc
cgatcaacaaagcttgtccatggaggattacgatatttgcagcaatttgaaattaaaatg
gtagcagaaattggtaaggaacgagagattgtttacgaaaatggaccgcatgtaacgacc
ccagagtggatgatgttgccattccataaaggcagcacattagggccattcacaacgaat
ataggactacgagtgtatgactttttggcaggggtgaagaaaagtgaacgccgaaaaatg
tttagtccagagcaagctttgcaaaaagaacctttaattaaaaaagatggactgaaaggt
gcaggttattatgtggaatataaaacagatgatgcaagattgactatagaggttatgaag
aaagctgtggaaagaggggctcatgcgataaattatgcaaaagtgacagaatttatttat
gatgaatctcataagatttctggaataacggtcgaggatcaaatcactcaagagacatac
agccttcatgcgaaaaagattattaatgctggtggtccttgggtcgatgaattacgagaa
attgatggttcgaaaaaaggtaaaaccttgcatttaacgaaaggaattcatcttgtattt
ccaaaagaggtattcccgttagaacaagcaatctattttgatacaccagacggacggatg
attttcgccataccacgagataataaaacatatgtagggacaacagatacaacgtatgag
ggtgatatagctcatcctgtaatgacagaggcagatgaaacctatgtactcgatgctatc
aattatatgttcccatcactcaatatgcagaaaaaggatgtagaatcaagctgggcagga
attcgtccattaattgaggaagaaggaaaaaatagcccgagtgaaatctcacgtaaggat
gaaatctttgtatctgattcaggtctaatctcaatggccggtggaaaattaaccggatat
cggaaaatggctgaacaggcagttgatacagtagttgaacaattaaaaactgaagaagga
attctatatacaaaatcggaaacaatcgatttacctatatctggtggagacgtgggtggt
tctaaaggttaccaaacatttctgcaaaggaaagtagctgatggtgttgctctaggatta
aataaaactacagctttagatttggcttcgatatatggatcgaatgttgatacactttat
gacatttatcaagatcgaaaagaagaggcggaaaaagagggaatcgatccagctgtattt
gccaaactcatttacgcaatggaaaatgaagcagcatataaacctgttgatttcttcatt
cgaaggacgggagcattgttttttgacataaattgggtgagaagaaacaaggaaaatgtc
atacaatatatggcgaagactttacgatggagcggagagcagaagcagcgttatattgcc
gaattagaacagttattgcatgaagcagttacaccaactatataa

DBGET integrated database retrieval system