KEGG   Oligotropha carboxidovorans OM4: OCA4_c00350Help
Entry
OCA4_c00350       CDS       T01967                                 

Gene name
fabI1
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
oco00061  Fatty acid biosynthesis
oco00780  Biotin metabolism
oco01100  Metabolic pathways
oco01130  Biosynthesis of antibiotics
oco01212  Fatty acid metabolism
Module
oco_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:oco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    OCA4_c00350 (fabI1)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    OCA4_c00350 (fabI1)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    OCA4_c00350 (fabI1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:oco01004]
    OCA4_c00350 (fabI1)
Enzymes [BR:oco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     OCA4_c00350 (fabI1)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     OCA4_c00350 (fabI1)
Lipid biosynthesis proteins [BR:oco01004]
 Fatty acid synthase
  Component type
   OCA4_c00350 (fabI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AEI01195
LinkDB All DBs
Position
complement(39164..39985)
Genome map
AA seq 273 aa AA seqDB search
MQSLMQGKRGLVMGVANDHSIAWGIAKALAAHGAELAFTYQGEALGKRVKPLAETLGAKH
VLPCDVEDIDSVDATFAALKDAWGKMDFLVHAIGFSDKNELKGRYADTTRANFSRTMVIS
CFSFTEVTKRAAELMPDGGSVVTLTFGGSTRVMPNYNVMGVAKAALEASVRYLAADYGRD
GIRVNAISAGPVRTLAGAGIGDSRAMFAFQQKHSPLGRGVTLDELGGTALYLLSELSGGV
TGETHFVDAGYNIISMPHPDALRADPGIPGNGQ
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcactgatgcaaggcaagcgcgggctcgtcatgggcgtcgccaacgatcactcg
attgcctggggcatcgcgaaggcgctcgccgcgcatggtgctgagctcgccttcacctat
cagggcgaagcactcggcaagcgggtgaagccgctcgccgaaacgcttggtgcgaagcat
gtcctgccctgtgatgtcgaggatatcgatagcgtcgatgcaacattcgccgcgctgaag
gatgcgtggggtaagatggattttcttgtccatgccatcggcttctccgacaagaacgag
ttgaagggtcgctatgccgacaccacgcgtgcgaatttctcgcgcaccatggtgatttcc
tgtttctccttcaccgaggtgacgaagcgtgccgcggagctgatgccggatggcggctcc
gtcgtgacgctcacttttggcggctctacccgcgtgatgccgaactacaatgtgatgggt
gttgcgaaggccgcgcttgaggcgtcggtccgctatctcgccgccgattatggccgtgac
ggcattcgcgtgaacgcgatctcggcaggcccggtgcgcacgcttgccggtgcgggcatc
ggggactcgcgcgcgatgtttgctttccagcagaagcattcgccgctcggccgcggcgtc
acgctcgacgagcttggtggcaccgcgctgtatctgttgtccgagctttccggtggcgtt
accggtgaaacgcattttgtcgatgcgggctacaacatcatctcgatgccgcatcccgat
gcgctgcgggccgatcccggcattcccggcaacggccagtaa

DBGET integrated database retrieval system