KEGG   Oligotropha carboxidovorans OM4: OCA4_c02300Help
Entry
OCA4_c02300       CDS       T01967                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit SdhB
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
oco00020  Citrate cycle (TCA cycle)
oco00190  Oxidative phosphorylation
oco00650  Butanoate metabolism
oco01100  Metabolic pathways
oco01110  Biosynthesis of secondary metabolites
oco01120  Microbial metabolism in diverse environments
oco01130  Biosynthesis of antibiotics
oco01200  Carbon metabolism
Module
oco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
oco_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:oco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OCA4_c02300 (sdhB)
   00650 Butanoate metabolism
    OCA4_c02300 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    OCA4_c02300 (sdhB)
Enzymes [BR:oco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     OCA4_c02300 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     OCA4_c02300 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_9 Fer2
Motif
Other DBs
NCBI-ProteinID: AEI01385
LinkDB All DBs
Position
complement(247085..247867)
Genome map
AA seq 260 aa AA seqDB search
MVEFALPKNSTISSGKTWPKPEGATETREYHIYRWSPDDNQNPRIDTYYVNTADCGPMIL
DGLIWIKNHIDPTLTFRRSCREGVCGSCAMNIDGQNTLACTCAASDVASGPITIRPLPHQ
PVVKDLVPDLTNFYAQYASIEPWLHTTTATPQKEWRQSIEERRELDGLYECILCACCSTS
CPSYWWNSDRFLGPAALLAADRWVKDSRDEATGERLDNLEDPFRLYRCHTIMNCTKACPK
GLNPSKAIADLKRKLVERQV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggttgaattcgcgctgccgaaaaactccaccatctcgagcggcaagacatggccgaag
cccgaaggcgccaccgagacgcgcgaatatcacatctatcgctggtcgcccgacgacaac
cagaacccgcgcatcgacacctattacgtcaacaccgccgattgcggcccgatgatcctc
gatggactgatctggatcaagaatcacatcgatccgacgctgaccttccgccgctcctgc
cgcgaaggcgtctgcggctcctgcgcgatgaacatcgacggccagaacacgcttgcctgc
acctgcgcagcaagtgacgtcgcgagcgggccgatcacgatccggccactgccgcatcag
ccggtggtgaaggatctcgtccccgacctcaccaacttctatgcgcagtacgcttcgatc
gagccgtggctgcacaccacgactgcgacgccgcagaaggaatggcggcagtcgatcgag
gagcgccgcgaactcgacggcctctacgaatgcatcctgtgcgcctgctgctcgacctca
tgcccgagctactggtggaatagcgatcgcttcctgggcccggccgcgctgcttgccgcc
gatcgctgggtgaaggattcgcgcgacgaagcaaccggcgagcggctcgacaatctcgag
gacccgttccggctttatcgctgccacaccatcatgaactgcaccaaggcgtgcccgaag
ggattgaatccctccaaggcgattgccgatctcaagcgcaagctggtcgagcggcaggtc
tga

DBGET integrated database retrieval system