KEGG   Oligotropha carboxidovorans OM4: OCA4_c02310Help
Entry
OCA4_c02310       CDS       T01967                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit SdhA
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
oco00020  Citrate cycle (TCA cycle)
oco00190  Oxidative phosphorylation
oco00650  Butanoate metabolism
oco01100  Metabolic pathways
oco01110  Biosynthesis of secondary metabolites
oco01120  Microbial metabolism in diverse environments
oco01130  Biosynthesis of antibiotics
oco01200  Carbon metabolism
Module
oco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
oco_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:oco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OCA4_c02310 (sdhA)
   00650 Butanoate metabolism
    OCA4_c02310 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    OCA4_c02310 (sdhA)
Enzymes [BR:oco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     OCA4_c02310 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     OCA4_c02310 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AEI01386
LinkDB All DBs
Position
complement(247967..249781)
Genome map
AA seq 604 aa AA seqDB search
MASNGKAAAGPAYPIEDHTYDVVVVGAGGAGLRAVVGCSEAGLRTACITKVFPTRSHTVA
AQGGISASLGNMHPDDWRWHMYDTVKGSDWLGDQDCIEYMVRNAPEAVYELEHWGVPFSR
TEDGKIFQRPFGGMTRDYGKGQAQRTCAAADRTGHAMLHTMYGQAVRHSAEFFIEFFAID
LIMDDQGVCRGAIALKLDDGTLHRFRAQTTILATGGYGRAYLSCTSAHTCTGDGGGMVLR
AGLPLQDMEFVQFHPTGIFPAGCLITEGARGEGGYLVNAEGERFMERYAPSAKDLASRDV
VSRAMTIEIREGRGVGKRKDHMFLHLDHLDPAVLHDRLPGISESARIFAGVDVTREPIPV
LPTVHYNMGGIPTNFHGEVVVKKRGDDDAVVPGLMAVGEAACVSVHGANRLGSNSLIDLV
VFGRSAALRCAEKLTPNGKQPELPADSAEKALARLDHFRYASGGTPTAKLRDSMQRVMQN
NCAVFRTGEVLHEGKDLIHKVHSGLTDISVTDRSLIWNTDLVETLEFDNLIIQAVVTMES
AVNRTESRGAHAREDFPERDDKNWMKHTLAWIDPKANTTIDYRPVHSYTMTNDIQYIPPK
ARVY
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcatccaacggcaaggctgcggcagggcccgcctatccgatcgaggaccacacctac
gatgtcgtcgtggtcggcgcgggcggtgcgggcttgcgcgccgtggtcggctgctcggaa
gcgggtttgcgcacggcctgcatcacaaaggtgtttccgacccgctcgcacactgtcgcg
gcgcagggcggcatctccgcttcgctcggcaacatgcatccggatgactggcgctggcac
atgtacgacaccgtgaaggggtcggactggctcggcgatcaggactgcatcgaatacatg
gtgcgcaacgcacccgaagccgtctacgaactcgagcattggggcgtgccgttctcccgc
accgaagacggcaagatcttccagcgcccgttcggcggcatgacccgcgactacggcaag
ggccaggcgcaacgcacctgcgccgctgccgaccgcaccggccacgccatgctgcatacg
atgtatggccaggcggtgcgccactcggcggagttcttcatcgagttcttcgccatcgat
ctcatcatggacgatcagggcgtctgccgcggcgcgatcgcgctcaagctcgacgacggc
acgctgcatcgtttccgcgcccagaccaccattctcgcaactggcggctatggccgcgcc
tatctctcctgcacctcggcacacacctgcaccggcgacggcggcggcatggtgctacgc
gcgggtctgccgctgcaggacatggagttcgtgcaattccatccgaccggcatctttccc
gcaggctgcctcatcaccgaaggcgcacgcggcgaaggcggctatctcgtcaatgccgag
ggcgaacgcttcatggagcgctatgcgccctccgccaaggacctcgcctcgcgcgacgtc
gtctcgcgtgcgatgaccatcgagattcgcgaaggccgcggtgtcggcaagcgcaaggac
catatgttcctgcacctcgatcatctcgatccggcagtgctgcacgaccggttgccgggc
atctcggaatcggcgcgcattttcgcaggcgtcgacgtcacccgcgaaccgatcccggtg
ctgccgacggtgcactacaacatgggcggcatcccgaccaacttccacggcgaagtggtt
gtgaagaagcgcggcgacgacgacgccgtggtgcccggcctgatggcggtcggcgaagcc
gcctgcgtctccgtgcatggcgcgaaccgcctcggctcgaactcgctgatcgatctcgtc
gtgttcggccgctcggcggcgctgcgctgcgccgagaagctcacgccgaacggcaagcag
ccggagttgcccgccgattccgccgagaaggccctcgcccgtctcgaccacttccgttac
gcctccggcggcacgccgaccgcaaagctgcgcgattccatgcagcgcgtgatgcagaac
aactgcgcggtgttccgcaccggcgaagtgctgcacgagggcaaggacctgatccacaag
gtccacagcggactcaccgacatcagcgtcaccgaccgctcgctgatctggaacaccgat
ctcgtcgagactctcgaattcgacaacctcatcattcaggcggtggtgacgatggaatcc
gctgtcaaccgcaccgagagccgcggcgcgcatgcgcgcgaggatttcccggagcgcgac
gacaagaactggatgaagcacacgctggcgtggatcgaccccaaggccaacaccacgatc
gattaccgcccggtgcacagctacacgatgaccaacgacattcagtacatcccgccgaag
gcgcgcgtgtactga

DBGET integrated database retrieval system