KEGG   Oligotropha carboxidovorans OM4: OCA4_c13880Help
Entry
OCA4_c13880       CDS       T01967                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase GlpD
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
oco00564  Glycerophospholipid metabolism
oco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    OCA4_c13880 (glpD)
Enzymes [BR:oco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     OCA4_c13880 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C P_proprotein Pyr_redox_2 Pyr_redox FAD_oxidored 3HCDH_N NAD_binding_8 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AEI02528
LinkDB All DBs
Position
1504168..1505679
Genome map
AA seq 503 aa AA seqDB search
MDHIYDLAIIGGGVNGCGIARDAAGRGYSVYLCEMNDLASGTSSWSSKLIHGGLRYLEFY
EFRLVREALIEREVLWGIAPHIIAPQRFVLPHHDGLRPAWLLRLGLFLYDHLGGRRRLPP
ARTLNLRRDIAGKPLKPGFKTGFSYSDCTVDDARLVVLNAQDAVARGATIATQTKAIRAE
RGDGVWQLEVEDATQARHTVKTRIVVNAGGPWVQDILTARVGVEATAHVRLVQGSHIVVP
RLYDNNYAYTFQHADGRVIFVIPYQRDFTLIGTTDRDYEGDPAAVRATQEEIDYLCAAAS
EYLATPVLPSDVVWSYSGVRPLYDDHASEARTATRDYMFELDAPEGLPVLSVFGGKITTY
RKLAEHALDKLSPYLRSAGKPWTADTPLPGGDFPMGEVDMLVQRLLREYPFLSQRHANRL
AHAYGTQAERVLGRAASFADLGRDFGHTLTEREVRYLMAHEFARTAEDVVWRRSKLGLWL
SREEIAALEAWMAAQSNLGAPAH
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
ttggatcatatctacgatctcgcgatcatcggtggtggcgtcaacggttgcggcattgcg
cgtgatgcggcggggcggggctattcggtctatttgtgcgagatgaacgatctcgcgagc
ggcacctcgtcatggtcgagcaagctcattcacggcggcttgcgttacctcgaattctat
gaattccgtctggtgcgcgaggcgctgatcgagcgcgaggtgctgtggggcatcgcgcct
cacatcatcgcgccgcaacgcttcgtgctgccgcatcatgatggcttgcggccggcatgg
cttctgcggctcgggctttttctctacgatcatctcggcggtcgccgccgtctgcctcct
gcacgcacgctgaatctgcgccgcgatattgcaggtaagccgctgaagccgggctttaaa
acgggcttttcctattccgattgcacggtggacgatgcgcgactcgtcgtgcttaacgcg
caggatgcagttgcacgcggcgcgaccatcgcgacacaaaccaaggcaatccgcgcagag
cggggcgacggcgtatggcagcttgaggtcgaagacgccacacaagcgcgtcacaccgtc
aagacccgcattgtggtgaatgccggcggcccctgggtgcaggatattctcaccgcgcgt
gtcggcgtcgaagcgacagcccacgtccgcctcgtgcagggctcgcacatcgtggtgccg
cggctttacgataacaactatgcctatacgttccagcacgccgacgggcgagtgatcttc
gtcattccctaccagcgcgatttcacgctgatcggcacgacggatcgcgattatgaggga
gaccccgcggcagtccgcgcgacgcaagaggagattgattatctctgtgccgctgcaagc
gaatatctcgcaacgcccgtcttgccgtccgatgtggtgtggagctattccggcgtgcgg
ccgctttacgatgaccatgcaagcgaggcacgcaccgccacgcgcgactatatgttcgag
cttgatgcgccggaggggctgcccgttctctcggtgttcggcggcaagatcacgacctat
cgcaagcttgccgaacatgcgctggacaagctgtcgccttacctccgcagtgcaggcaag
ccgtggacggcggatacgccgctaccgggtggcgattttccgatgggcgaagtcgatatg
ctcgtgcagcgcctcttgcgggaatacccgttcctgtcgcaacgccacgccaatcgactc
gcacatgcttatggcacgcaggccgagcgtgttctcggtcgggcagcaagtttcgccgat
ctcggccgagatttcggtcataccctgaccgagcgcgaggtgcgctatctgatggcgcat
gagtttgcgagaacggcggaagatgtcgtatggcgacgttccaagcttggcctgtggctg
tcgcgcgaagaaattgcagcgcttgaggcttggatggcggcgcaatcaaaccttggtgcg
cccgcgcattga

DBGET integrated database retrieval system