KEGG   Oligotropha carboxidovorans OM4: OCA4_pHCG3B00480Help
Entry
OCA4_pHCG3B00480  CDS       T01967                                 

Gene name
cbbS
Definition
(GenBank) ribulose bisphosphate carboxylase small chain CbbS
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
oco00630  Glyoxylate and dicarboxylate metabolism
oco00710  Carbon fixation in photosynthetic organisms
oco01100  Metabolic pathways
oco01120  Microbial metabolism in diverse environments
oco01200  Carbon metabolism
Module
oco_M00165  Reductive pentose phosphate cycle (Calvin cycle)
oco_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:oco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OCA4_pHCG3B00480 (cbbS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OCA4_pHCG3B00480 (cbbS)
Enzymes [BR:oco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     OCA4_pHCG3B00480 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AEI04494
LinkDB All DBs
Position
pHCG3B:50525..50950
Genome map
AA seq 141 aa AA seqDB search
MRITQGCFSFLPDLTDEQIKKQIQYCLGKDWAVNIEFTDDPHPRNTYWEMWGLPMFDLRD
AAGIMMELKECRKVYGDRYIRINAFDSSHGWESVRISFIVNRPKNEPGFRLARQEVGGRN
MRYTTTSYAADRPEGQRYNGA
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattacacaaggttgcttttccttcctccccgatctgaccgacgaacagatcaag
aagcagatccagtattgcctcggcaaggattgggccgtgaacatcgaattcacggacgat
ccgcacccgcgcaacacgtattgggagatgtggggcctgccgatgttcgatctgcgcgat
gccgcaggcatcatgatggagctgaaggagtgccggaaggtctatggagaccgctacatc
cggatcaatgccttcgactccagccatggttgggaatcggtgcgcatttcgttcatcgtg
aaccgcccgaagaacgagcccggcttccgtctggcacgtcaggaggtcggtggccgtaac
atgcgttacaccacgacgtcctatgcggccgatcgccctgaaggtcagcgctacaacgga
gcatga

DBGET integrated database retrieval system