KEGG   Oryctolagus cuniculus (rabbit): 100008602
Entry
100008602         CDS       T03373                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03050  Proteasome
ocu04060  Cytokine-cytokine receptor interaction
ocu04066  HIF-1 signaling pathway
ocu04217  Necroptosis
ocu04350  TGF-beta signaling pathway
ocu04380  Osteoclast differentiation
ocu04612  Antigen processing and presentation
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04940  Type I diabetes mellitus
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05143  African trypanosomiasis
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05200  Pathways in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05321  Inflammatory bowel disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    100008602 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100008602 (IFNG)
   04630 JAK-STAT signaling pathway
    100008602 (IFNG)
   04066 HIF-1 signaling pathway
    100008602 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100008602 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100008602 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100008602 (IFNG)
   04612 Antigen processing and presentation
    100008602 (IFNG)
   04660 T cell receptor signaling pathway
    100008602 (IFNG)
   04658 Th1 and Th2 cell differentiation
    100008602 (IFNG)
   04659 Th17 cell differentiation
    100008602 (IFNG)
   04657 IL-17 signaling pathway
    100008602 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100008602 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100008602 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100008602 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100008602 (IFNG)
   05323 Rheumatoid arthritis
    100008602 (IFNG)
   05321 Inflammatory bowel disease
    100008602 (IFNG)
   05330 Allograft rejection
    100008602 (IFNG)
   05332 Graft-versus-host disease
    100008602 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100008602 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100008602 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100008602 (IFNG)
  09172 Infectious disease: viral
   05164 Influenza A
    100008602 (IFNG)
   05160 Hepatitis C
    100008602 (IFNG)
   05168 Herpes simplex virus 1 infection
    100008602 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100008602 (IFNG)
   05144 Malaria
    100008602 (IFNG)
   05145 Toxoplasmosis
    100008602 (IFNG)
   05140 Leishmaniasis
    100008602 (IFNG)
   05142 Chagas disease
    100008602 (IFNG)
   05143 African trypanosomiasis
    100008602 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:ocu03051]
    100008602 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100008602 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100008602 (IFNG)
Proteasome [BR:ocu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100008602 (IFNG)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100008602 (IFNG)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Haparin
  Cytokines
   100008602 (IFNG)
SSDB
Motif
Pfam: IFN-gamma
Other DBs
NCBI-GeneID: 100008602
NCBI-ProteinID: NP_001075460
Ensembl: ENSOCUG00000024937
UniProt: P30123 A5JW26
LinkDB
Structure
PDB: 
2RIG

Position
4
AA seq 167 aa
MSYTSYILAFQLCLILGSYGCYCQDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWK
EESDNKIIQSQIVSFYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNLTR
ISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRGRRASKY
NT seq 504 nt   +upstreamnt  +downstreamnt
atgagttatacaagttacatcttggcttttcagctctgcctcatcttgggttcttacggc
tgttactgccaggacacactaaccagagaaacagaacacctaaaggcatatttgaaagca
aatacatcagatgtggcaaatggtggaccccttttcttgaatattttgaggaattggaaa
gaggagagtgacaacaaaataattcagagccaaattgtctccttctacttcaaactcttt
gacaacttaaaagaccatgaggtcatcaagaagagtatggaatccatcaaagaagacata
tttgtgaagttcttcaatagcaacctcactaagatggatgacttccaaaatctgactcga
atttcggtggatgatcggctggtccagcgtaaagcagtaagtgaactctccaatgtgctg
aattttctgtctccaaaatccaacctaaagaagcgaaaaaggagtcagacgctgtttcga
ggtcggcgagcatccaagtactga

DBGET integrated database retrieval system